(data stored in ACNUC10821 zone)

EMBL: AE017262.PE666

AE017262.PE666       Location/Qualifiers
FT   CDS_pept        complement(691427..693268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0675"
FT                   /product="sulfatase family protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0675"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03456"
FT                   /protein_id="AAT03456.1"
FT                   /translation="MLERGIQLILFYFLLIIGKFTFAYFQIFKDPNFLALGMDLLFIVL
FT                   LLGLIHLFAPVRSHIYWYAGMSLFIGILMLVCVLYARFYNEVPTYHSFSLIGEVGVVKN
FT                   SATSLLSGTDWLYILDIVLLPFILYFHIKKGHEFPSFRITSRVYGVSFISTLLVLSGFT
FT                   YFMMQQNIISDSKRAKRMGIFTFNISTALTGADHVKAADITAKNVNDIKGVSVKSNPDY
FT                   FGAAKGKNLIIVQLESFQRNLTNVKINGQSITPTLDSLQNETMYSNQFFQTVSKSNTAD
FT                   AEWSVYTSTFPSGYYTNTQTYGDRVIPSMPRLLGKNDYKTATFHTNDASFYNRDEFYPA
FT                   VGFDKFYDRKFFGDEDVIGFSPSDEVLYNKAFPILEEQYKNNQKFYAQLISVSSHMPFD
FT                   IPKDKQEIDLPSDLKDTELGNYFEAVHYADKQLGEFIQKLKDSGIWDDSVVVFYGDHHI
FT                   IKTDQLPEEQKKYVNRSTELKADPADDYRIPFFLHYPGMENPGEIKNVGGEIDIMPTVM
FT                   NLLGIKTGDQIMFGTDILNSSNNYVPERYTMPEGSYFTNSYMYQPDESFETGAATNYDG
FT                   TNKELSSDVKKRFDASRKLLQYSDSYVNNLPLRDEDK"
     atgctagaaa gaggaattca gttgatttta ttttattttt tattaattat tggtaagttc        60
     actttcgcct atttccagat ttttaaagat cctaacttct tggcacttgg aatggacctg       120
     ctgtttatcg tcttacttct tggactaatt catttatttg caccggttcg ctcgcacatt       180
     tattggtatg cgggaatgtc tttatttatt gggattttaa tgctcgtgtg tgtactttac       240
     gcccggtttt ataatgaagt tccaacatat cacagcttct ctcttatcgg cgaggttggc       300
     gtagttaaaa acagtgctac aagcctgcta agcggaacag actggttgta catcctagat       360
     atcgttttac tcccatttat cctttatttc catatcaaaa aaggacacga gttcccttca       420
     ttccgcataa ctagccgtgt ttatggcgta tcatttatta gtacgctact cgttttaagt       480
     ggttttactt attttatgat gcaacaaaac attatcagtg actccaagcg cgcaaaacga       540
     atgggaattt tcacatttaa tatcagtacc gcgcttactg gtgcagatca tgttaaagcc       600
     gcagatatta ctgcaaaaaa cgtgaatgac attaaaggtg tgtcggttaa gtcaaatccc       660
     gattacttcg gtgctgctaa aggaaaaaat cttattatcg ttcaactcga gtcattccag       720
     cgtaatttaa cgaacgtcaa aattaacggt cagtcgatta cgcctacatt agatagctta       780
     caaaacgaaa ccatgtattc caaccaattt ttccaaactg tctctaagtc aaatacggct       840
     gatgcagaat ggtccgttta tacatcgact ttcccaagtg gatattacac gaacacacaa       900
     acttacggcg accgggtaat cccgtctatg cctcgtttac ttggcaaaaa tgattataaa       960
     acagcgacct tccatacaaa tgatgctagt ttttacaatc gcgatgaatt ttatcctgct      1020
     gtaggatttg ataagtttta tgatcgtaaa ttctttggcg atgaggacgt tattggcttt      1080
     tctcctagtg atgaagtgct ttataacaaa gcctttccga ttctagaaga gcagtacaaa      1140
     aacaaccaaa aattctatgc gcaattaatt agtgtaagta gtcatatgcc atttgatatt      1200
     ccaaaagata agcaagaaat cgacttaccg agcgatttaa aagatacaga acttggtaac      1260
     tatttcgaag cggttcatta tgcggataaa caacttggtg aattcattca aaaattaaaa      1320
     gatagcggca tttgggatga ttctgttgtc gttttctacg gcgatcatca cattatcaaa      1380
     accgaccaac tacctgagga acaaaaaaaa tacgtcaatc gttctactga gttaaaagcg      1440
     gatccagccg atgattaccg tattccgttc ttcttacatt atcctggcat ggaaaaccct      1500
     ggtgaaatta aaaatgttgg tggcgaaatt gatattatgc caactgtcat gaatttactt      1560
     ggtattaaaa ctggtgacca aattatgttt ggaaccgata tcctcaattc atcaaataat      1620
     tacgtacctg aacgctacac aatgccagaa ggaagttatt tcaccaattc ttacatgtac      1680
     caaccagatg aaagtttcga aactggcgca gcaacgaatt atgatggaac aaacaaagaa      1740
     ctttcgagtg atgtaaagaa acgctttgac gctagccgaa aactcttaca gtattctgat      1800
     agctatgtaa acaatttacc attacgagac gaagataaat aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page