(data stored in ACNUC10821 zone)

EMBL: AE017262.PE667

AE017262.PE667       Location/Qualifiers
FT   CDS_pept        693482..694873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0676"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0676"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03457"
FT                   /protein_id="AAT03457.1"
FT                   /translation="MNSLFRRKPIEDLMHNKSGSTHLKQTLGPLDLTLLGVGAIVGTGI
FT                   FILPGTVAAKNAGPAIIFSFVIAAIVCAIAAMCYSEFASSVPVAGSAYTYGYVVFGELI
FT                   GWLLGWALILEYGLAVASVASGWSSYLNALLSGFHISIPEAISGPFNPEVGTFINLPAI
FT                   IIVLVIAFLLTLGIKESTRVNTIMVVIKVGVILLFLVVGVFYVKPDNWQPFMPFGISGV
FT                   MNGAALVFFAYLGFDAVSSAAEEVKDPQRTMPIGIIGSLLICTVLYVAVSAVLTGMVPY
FT                   TDLNVTDPVAYALQVINQDWVAGIVSLGAVVGMITVILVMSYGATRLIFAMGRDGLLPK
FT                   VLAEINQKYQTPVKNTWIFAVIVAIISGLVPLDRLAELVNIGTLLAFMMVSIGIIFLRK
FT                   NKDIQARGFKVPFYPVLPIVSFLLCAFLISRLSVHTWILCGIWFVIGLIVYFAYGRKHS
FT                   ELLKK"
     atgaattcat tatttagaag aaaaccgata gaagatttaa tgcataataa aagtggtagc        60
     acgcatttaa agcaaacgct cggaccactt gatttaactt tacttggagt cggagcgatt       120
     gttggaacgg ggatttttat tttaccagga acagtcgcag cgaaaaatgc gggaccagcg       180
     attattttct cttttgtgat tgcggcgatt gtttgtgcga ttgcagcaat gtgttactca       240
     gagtttgcgt ctagtgttcc ggttgcaggg agcgcctata cgtatggtta tgttgttttt       300
     ggtgagttaa ttggatggtt gcttggttgg gcacttattt tagaatacgg gcttgcagtg       360
     gcttctgttg cgagtgggtg gtcttcttat ttaaatgcgt tactttcagg ctttcatatt       420
     tccatcccag aagcaatctc tgggcctttt aatccagaag taggtacatt tattaattta       480
     ccggcgatta ttattgttct tgtgattgcc tttttattga cgcttgggat aaaagaatca       540
     acgcgcgtga ataccattat ggtagttatt aaagttggtg ttattttact tttcttagtt       600
     gttggtgtat tttatgtcaa accggataat tggcaaccgt ttatgccatt tggaattagt       660
     ggcgttatga atggtgcggc gctagttttc tttgcttatt taggttttga tgccgtttcg       720
     tctgcagctg aagaagtgaa agatccgcaa cggacaatgc cgattgggat tataggctcg       780
     ctacttattt gtacggtgtt atatgttgct gtatccgctg ttttaactgg aatggtaccg       840
     tacacagatt taaacgtaac agatccagtg gcttatgctt tgcaagtgat taaccaagat       900
     tgggtagctg gcattgtatc acttggcgcg gttgttggga tgattacagt aattttagta       960
     atgagttacg gggcgactag attgattttt gcgatgggac gtgatggttt attaccaaaa      1020
     gtacttgcag aaattaatca aaaatatcaa acacctgtta aaaacacctg gatttttgca      1080
     gtgatagtcg cgattattag tgggcttgta ccattagatc gattggctga gttggttaat      1140
     attggaacac tcttggcgtt tatgatggtg tctatcggga ttatcttttt acgtaaaaat      1200
     aaagatattc aagcgagagg atttaaagta ccattttatc cagttcttcc aattgtttcg      1260
     ttcttattat gtgcgttttt aattagccgt ctgtctgttc atacgtggat tctttgcgga      1320
     atttggtttg ttattggttt aattgtttac tttgcttatg gtagaaaaca tagtgaatta      1380
     cttaaaaaat aa                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page