(data stored in ACNUC10821 zone)

EMBL: AE017262.PE668

AE017262.PE668       Location/Qualifiers
FT   CDS_pept        694963..695802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0677"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by similarity to OMNI:EF0656; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0677"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03458"
FT                   /protein_id="AAT03458.1"
FT                   /translation="MAEISEELRLGEVVLNVGHLKEMAGFYQEVIGLKLLEENERMVRL
FT                   GVSGSDEALLVLKKIDNAVVPEVPRIGLFHTAFLLPTRESLADVLLHLAKSGYPIDGAG
FT                   DHAYSEALYLHDIEGNGIEIYADRPKAEWMRDGDGNLPMVTEQVDVDSLLQIATDEPFT
FT                   GMPNGTIIGHVHLQVADADKAEQFYKEVLGMNLTTAIPSARFFAAGDYHHHIGSNVWAG
FT                   RNLELLQENETGLAWFTIITPDKDAIITNLIEQGYDVKRLENTISVTDSNGIKIHFK"
     atggcagaaa ttagtgaaga attacgactt ggcgaagttg tattgaatgt tggacattta        60
     aaagagatgg caggttttta tcaagaagta attggtttga agttattaga ggaaaatgag       120
     cgaatggttc ggctcggcgt gagtgggtct gatgaagctt tacttgttct taaaaagata       180
     gataatgcgg ttgttccaga agtgccgcgt attggcttgt ttcataccgc ctttcttttg       240
     ccaacgcgag aaagtttagc ggatgtgtta ctgcatttgg ctaaatcagg ttatccgatt       300
     gatggcgcgg gagatcatgc ttatagcgag gcgctttatt tacatgatat tgaaggcaat       360
     ggcattgaaa tttatgcaga ccgtccaaaa gcagaatgga tgcgtgatgg cgatggcaat       420
     ttaccgatgg tgacagaaca agtagatgtg gattcgttgc ttcaaattgc gaccgatgaa       480
     ccatttacag ggatgccaaa cggaacgata attggtcatg tgcatttaca agtggcagat       540
     gctgacaaag cggaacaatt ttataaagag gtacttggaa tgaacttaac gaccgctatt       600
     ccgtcagcaa ggttttttgc ggctggtgat tatcatcatc acatcggttc aaacgtctgg       660
     gcaggtcgca acttggaact tctgcaagaa aatgaaacgg gactcgcttg gtttacaatt       720
     attactcctg ataaagatgc aataataacc aacttaatag aacaaggata tgatgtgaaa       780
     cgattggaaa atactatttc cgtgacagat tctaacggaa ttaagattca cttcaaataa       840
//

If you have problems or comments...

PBIL Back to PBIL home page