(data stored in ACNUC10821 zone)

EMBL: AE017262.PE669

AE017262.PE669       Location/Qualifiers
FT   CDS_pept        complement(695885..696169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0678"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0646"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0678"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03459"
FT                   /protein_id="AAT03459.1"
FT                   /translation="MEFMSMIVTGIVLAAIISGLSFVVGKLSGLSWFWIAFCANSGFFI
FT                   IFITVQNSFPDNAAVALSYLNLGIGVVLIALTLFQSSNWLFKKTMQRKH"
     atggaattta tgtctatgat agttacagga attgttttag cagcaataat ctcaggactt        60
     tcttttgtgg ttggtaaact tagtggatta tcttggtttt ggattgcgtt ttgtgcaaat       120
     agcggtttct ttattatttt catcactgtg caaaattcat ttccagataa cgcagccgta       180
     gccctttcgt atttaaatct tggaattggc gtagttttaa ttgctttaac gcttttccaa       240
     tctagcaatt ggcttttcaa gaaaacaatg caacgtaaac attaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page