(data stored in ACNUC10821 zone)

EMBL: AE017262.PE670

AE017262.PE670       Location/Qualifiers
FT   CDS_pept        696267..697217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0679"
FT                   /product="magnesium transporter, CorA family"
FT                   /note="identified by match to protein family HMM PF01544"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0679"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03460"
FT                   /protein_id="AAT03460.1"
FT                   /translation="MIEFFKTTNEKMEQISALEDGCWVKVTAPTDDEIEMLSKEMDVPK
FT                   PYILDALDSEERSRIELKRAEQDVRHSLVIVDYPYESEDELGYAMYETLPIGIVLTRKH
FT                   LVTITLRDLPILKDVQSMKLEEYDTTNHKQFLLKLLYAVSYYYLKYLNQIIKQTNNLEI
FT                   QIKQSMKNEQLYAFMAVQKSLVFFATALQSNKAILDKMEDVEHFMQQEDNHDLLRDVII
FT                   ENKQAIAMTDTYTQIISGMSDVFSSVISNNLNIVMKFLTSFTIILSLPTIVASIYGMNI
FT                   KLPFMHNEHAFALILLFTLLITTGVTVIFWRRKYF"
     atgattgaat tttttaagac aacaaatgaa aaaatggagc aaatttctgc tttggaagat        60
     ggttgttggg taaaagtaac tgctccaaca gacgacgaaa tagaaatgtt gagtaaggaa       120
     atggatgtgc ccaaaccgta tattttggat gcattagatt ctgaggagcg ctctaggata       180
     gaattaaaac gagcagagca agatgtaaga cattcactag tcattgtaga ttatccatac       240
     gaatcggagg atgaactagg ctacgcaatg tatgaaacac ttccgattgg gattgtttta       300
     actagaaaac atcttgtaac aatcacgttg cgagatctgc caattctaaa agatgtgcaa       360
     tcgatgaagt tagaagaata tgatacaacc aatcataagc aatttttgtt aaaattattg       420
     tacgctgtat cttattatta cctcaaatac ttaaatcaaa tcattaaaca aacaaataat       480
     ttagaaatac agattaaaca atcgatgaaa aatgagcaac tgtatgcttt tatggcagtt       540
     cagaaaagtt tagtattttt tgcaacggcc cttcaatcga ataaagcaat tctcgataaa       600
     atggaagatg tagaacattt tatgcagcaa gaggataatc atgatttgct cagagatgtt       660
     attattgaaa ataagcaagc aattgcaatg acggatacat atacccaaat aattagcggg       720
     atgtcggatg tattttcttc ggttatttcg aacaatttaa atatcgtgat gaaattttta       780
     acatcattta ccattatttt gtcattaccc acgattgtgg ctagtattta tgggatgaat       840
     attaagctac cattcatgca taatgagcac gcatttgcat taattctttt atttacgctt       900
     ttaattacaa cgggagtaac tgtcattttt tggcgtagaa aatactttta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page