(data stored in ACNUC10821 zone)

EMBL: AE017262.PE678

AE017262.PE678       Location/Qualifiers
FT   CDS_pept        704427..706565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0687"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01HP01062"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0687"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03468"
FT                   /protein_id="AAT03468.1"
FT                   /translation="MKIELATRKNVFQEDNIEFKRKNFIFGKNGSGKSTLCDLIKMQKH
FT                   LYQTEMNSNYELVEVKEDGEYVLANNQEEKFDVQIFQGFDSVIGENNNLNAIALSAGNK
FT                   VIEDKLPILNRELEALNDEKKIKNNIYLKAKEKHNFQESKIDNWYSVAAKSIKRNTQYQ
FT                   IDPNYNKRKFKDDINKSKRIENVEELNSIIKETPKNPVVDYFFDIPNLKEILNLVNDIL
FT                   VKTVEIPQKCNELNTSEKEKFARKGLNLHEENDDCLFCGNKLTRDRMNKLNQHFNEGYQ
FT                   KLEEEVLSIEIEKITFQKIKQQEFYAKFDVEEINNIILEKENEINRFLENLLNAINEKK
FT                   EDITKIFNILELEIPQITNLQIKINELIRENNIFGENLNNNIKIAKESIKYHLISIECE
FT                   KFNFNVEKNELNNLKLQIPDLTKINQEIEEKNKEIQELKNQQKDTSKIAQLINERLKKA
FT                   GKDDLQLKKIENDGFERYEIQDGENEVRSINKISTGEKNIIAFLYFIYSLEDIENQKNK
FT                   PKIIIFDDPMNSNDDTMQYLIITELQKLYSGIDKNKFNHEKDYFLCLTHNVHFYLNVQP
FT                   HGNHKDSKGRTKYDKSNFFRIENKKFRLIKNEKEDIKTNYAGLWIELSELCERNLRYAI
FT                   LNSMRRIIETFVKFNNLNTDDFYRENAIYKKLFDVGSHSIDDLTHEQFTETPAELKLIF
FT                   SNLFEENGFEDHFKNYWK"
     atgaaaattg aactagcaac taggaagaat gtttttcaag aagataacat tgaatttaaa        60
     aggaaaaact ttatatttgg aaaaaacggt tctggaaaat caacactttg cgatttgata       120
     aaaatgcaaa aacaccttta tcaaactgaa atgaactcaa actacgaact agtagaagtt       180
     aaagaagatg gagaatacgt tctagctaac aaccaagaag aaaaatttga tgtgcaaatt       240
     tttcaggggt tcgatagtgt cataggagaa aataataact taaatgcgat tgcattgagt       300
     gctggaaata aggttattga agataaatta ccaatattga atagagagct agaagcgtta       360
     aatgatgaga aaaagataaa gaataatata tatttaaaag ctaaggaaaa acataacttt       420
     caagaaagta aaatagataa ttggtactca gttgctgcaa aatcaatcaa acgaaatact       480
     caatatcaga ttgatcctaa ttataataag cgtaagttta aagacgacat aaataaaagc       540
     aaaagaattg aaaatgtaga agaattaaat agcataatta aggaaacgcc taagaatcca       600
     gttgttgatt acttttttga tattcctaac ttgaaagaga ttcttaattt agtaaatgat       660
     attttagtca agacagttga aattcctcaa aagtgtaacg agctaaatac ttctgagaaa       720
     gagaagtttg cgaggaaagg tttaaatctt cacgaagaaa atgatgattg tttattttgt       780
     ggaaataagt taaccaggga tagaatgaat aaattaaacc aacattttaa tgaaggatat       840
     cagaaattag aagaagaagt tttaagcatt gaaattgaaa aaatcacatt ccagaaaata       900
     aaacagcaag aattttatgc taaatttgat gttgaagaaa taaataatat aattttagaa       960
     aaagaaaatg agattaatag attccttgaa aatctgctga atgcaataaa tgaaaagaaa      1020
     gaagatatta ctaaaatttt taatatttta gaactagaaa tccctcaaat tacaaattta      1080
     caaataaaaa ttaatgaact aatacgagaa aataatattt ttggtgaaaa tttaaataat      1140
     aatattaaga ttgctaaaga gagtattaag taccatttaa ttagtattga atgtgagaaa      1200
     tttaacttta atgttgaaaa aaatgaatta aacaatttaa aattacaaat tcctgattta      1260
     acaaaaatta accaagaaat tgaagagaaa aataaagaaa ttcaagaatt gaaaaatcag      1320
     caaaaagata catcgaaaat tgcacaatta ataaacgaaa gattgaaaaa agcaggtaag      1380
     gatgatctac aacttaaaaa aatagagaat gatggatttg aaagatacga aattcaagat      1440
     ggagaaaatg aagttcgtag tataaataaa atctcaacgg gagagaagaa tataattgca      1500
     tttttatact ttatatactc tcttgaagat attgaaaatc aaaaaaataa acctaagata      1560
     attattttcg atgaccctat gaattcaaat gatgatacta tgcaatattt aataataaca      1620
     gagttacaaa agctttattc tggaattgat aaaaataagt ttaatcatga aaaagattac      1680
     ttcctttgcc taactcacaa tgtacacttc tatctaaatg tacagcccca cggaaatcat      1740
     aaagacagta aaggtagaac aaagtatgat aaaagtaatt tttttagaat tgaaaataaa      1800
     aaattcagat taataaaaaa tgagaaggaa gatattaaaa cgaattatgc aggactgtgg      1860
     atagaattaa gcgaactatg tgaacgtaat cttaggtatg caatcctaaa ctcaatgcga      1920
     agaataattg aaacttttgt gaaattcaac aacttaaata cagatgattt ttatcgagag      1980
     aatgcgatat ataagaagct ctttgatgtg ggctctcatt ctattgatga cttgacacat      2040
     gaacaattca cagaaacacc tgcagaatta aaattaattt tttcaaatct atttgaagaa      2100
     aatggatttg aggatcattt taaaaattat tggaaataa                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page