(data stored in ACNUC10821 zone)

EMBL: AE017262.PE680

AE017262.PE680       Location/Qualifiers
FT   CDS_pept        707378..707794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0689"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0656"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0689"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03470"
FT                   /protein_id="AAT03470.1"
FT                   /translation="MSIIARELTKAEEAEIVRLKEEGEVMLQTDGTPEERIEKITEYLK
FT                   NTSPDPDLAEELGYILGSLYGEAVREKYEWRWLFVSENDLEGYAITSKEHGYTFMVHDY
FT                   FMQVIVQNKPDNSKMLFELMVDMTGNRNDFRMIG"
     atgtcgatta ttgcacgaga actaacgaaa gcggaagaag ctgaaattgt ccgtttaaaa        60
     gaagaaggcg aagtaatgct ccaaacggac ggaactccag aagaacgcat cgagaaaatt       120
     actgagtact taaaaaatac ctcgccagac cctgatttag cagaagagct tggttatatt       180
     ttaggctctt tgtacggaga ggcagtgcgt gaaaagtatg agtggcgctg gctgtttgtc       240
     tcagaaaatg atttagaagg ctacgcgatt acgtcgaaag agcatggcta tacatttatg       300
     gtgcatgatt attttatgca agtaatcgtt cagaataagc cagataatag caaaatgcta       360
     tttgaattga tggttgatat gactgggaat cgaaacgatt ttcggatgat tggttaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page