(data stored in ACNUC10821 zone)

EMBL: AE017262.PE681

AE017262.PE681       Location/Qualifiers
FT   CDS_pept        707837..708466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0690"
FT                   /product="endonuclease III domain protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0690"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03471"
FT                   /protein_id="AAT03471.1"
FT                   /translation="MNVNEQKVLVLNNLVEHYGYQDWWEADNRLADWLSMILIQRTTEK
FT                   NAKQALANLAPYLDLDSLIEMDKAKLEELIYPAGFYKQKSIYIKALAEWFYGHGASLDK
FT                   FQTYSTEALRKELLGIKGVGEETADAMLLYIFERNVFIADLYARRLFTRLGFGEYTTYA
FT                   QMRDEFMPIIENIPHKLCKEWHSVIDVHGKHFGKDKSMNESWLLES"
     gtgaatgtaa acgaacaaaa agtgttagtt ttaaataatt tagtggagca ttatggttat        60
     caagattggt gggaagcgga taatcgtctg gctgattggc tttcgatgat attaatccag       120
     cgtacgacag agaaaaatgc caaacaagca ttagcgaacc ttgcaccata tttagattta       180
     gatagcttaa ttgaaatgga taaagcgaaa ttggaagaat taatctatcc agcgggtttt       240
     tataaacaaa aaagtatcta tattaaagca cttgctgagt ggttctatgg tcacggagct       300
     agtttagata agtttcagac gtattcaacg gaagctttac gaaaagagtt gttaggcata       360
     aagggtgtcg gggaagaaac ggcggatgca atgttgctgt atatttttga gcggaatgtg       420
     tttattgctg acttatatgc cagacgacta tttactaggt tgggttttgg tgaatataca       480
     acttatgcac aaatgcgcga tgaatttatg ccaataatag agaatattcc acataaacta       540
     tgtaaagaat ggcactcagt cattgatgtt cacggaaaac attttgggaa agacaaaagt       600
     atgaatgaat cttggctgct agaaagctag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page