(data stored in ACNUC10821 zone)

EMBL: AE017262.PE683

AE017262.PE683       Location/Qualifiers
FT   CDS_pept        709593..709874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0692"
FT                   /product="putative transposase OrfA, IS3 family"
FT                   /note="This gene is marked putative because transposase
FT                   OrfB appears to be missing.; identified by similarity to
FT                   OMNI:NTL01LL0091; match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0692"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03473"
FT                   /protein_id="AAT03473.1"
FT                   /translation="MAKAKYDENFKKSLVALYRRGKTKHSICQEFSVPNSTFGKWIKKF
FT                   NNDDNIESNEILNILQAQELKKQRALLEEELSILTEAINVFENPPIKN"
     atggctaaag caaaatatga cgagaatttc aaaaaaagtt tggttgcttt atatcgcaga        60
     gggaaaacga agcatagtat ctgtcaggaa tttagtgtcc ctaattcaac ttttggaaaa       120
     tggataaaaa aatttaataa tgatgacaat attgaatcga acgaaatctt aaatatcttg       180
     caagcgcagg aactaaaaaa acaacgggcg ctattagaag aagaattatc tatcttaaca       240
     gaagcaatta atgtctttga aaacccgcca attaaaaatt ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page