(data stored in ACNUC10821 zone)

EMBL: AE017262.PE684

AE017262.PE684       Location/Qualifiers
FT   CDS_pept        710152..712626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0693"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0693"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03474"
FT                   /protein_id="AAT03474.1"
FT                   /translation="MKKILHIVIALSVICSIILVPVDWSAKAGGNNKRDDLIKSVSFYN
FT                   SNGKNVTAKENYNEKLNYFLEVAFGGNSFQKGDYFNITLSSDALLYTEKAYDLKVDIDP
FT                   TAVTNEQVVGKVTVEKINGSPTLHFVFTEDSESFFINSFDASFKIQVMPAHGDKNVINL
FT                   SYSGAAKNFKNIGTSSVEWNVNMADDWPPVGISDFSKISGDLYHAILVYEKPSSKVNYE
FT                   TEILVSYPLFEKRIPLGNVQNIKIEVWDEAKEIYRVGVAGVDYGTITYDVGTPFVGGPI
FT                   FQMNCTIPFKGISTKTRVSFDIDTNVDGKPGTTDPYLVSLSSVSSATKSLEFYPVNNAV
FT                   TQMTATFFGKVTTRFEDELGNPVTFDNYSTVTTPGKVNQDGKFEIAEPFLHNSVQNVDK
FT                   HAYDTLLDTNKYKLLEVTSPNKLSETADNLSIQIKRGYQNDVLYKIKALQKPVISALPE
FT                   IEYSKTVNRTMEEFLEDVEAKTDIPADIDCDLTNVKWGVPGDYLVLITAVNEDNQAADP
FT                   VPVTIKISKNPAPVITVDPEIIYDKTVTKEESTLLNEVNARTNDGSTITSNINDKVKWG
FT                   VPGDYEVTLNAVNEDGVAAESKTFIVRILKSPAPIITVDPEITYPKTITKTEAELLQEV
FT                   NAQTNDGSPLVSDMNDKVKWGVPGDYEVTLNAINEDGVAAESKTFVVRILKSPAPIITV
FT                   DPEITYDSSVIKDERELLKDVHARSSDGSVLTSDSQVKVKWKKTGSYTVTLNAVNEDGI
FT                   SANSVQFTVHIVDAKAIPVVIEEKPESTPKPDTKEKVVIKKEKLPKTGDTNTKTILSGI
FT                   FCLGAWYLLRRK"
     ttgaagaaga ttttacatat tgttatcgca cttagtgtaa tttgttcgat aattttagtg        60
     ccagtagatt ggtccgcaaa agcaggcggt aataataagc gagatgatct tattaaatct       120
     gtcagttttt ataattcaaa tggaaaaaat gtaacggcga aggaaaacta taatgaaaaa       180
     ctaaattatt ttttagaagt agcttttgga gggaattctt tccaaaaagg ggactatttt       240
     aatattactt tatcatctga tgccttactc tatacagaga aagcctatga tttgaaagtg       300
     gatattgacc caacagcggt aactaatgaa caagtagttg gtaaagttac tgtagaaaaa       360
     attaatggat caccaacatt gcactttgtt tttacagaag attcagagtc tttttttata       420
     aacagctttg atgcgagttt taaaatacag gtgatgccag cgcatggcga taaaaacgtt       480
     attaatcttt cctatagtgg cgctgcaaaa aactttaaaa acattgggac gagcagtgtg       540
     gaatggaacg taaatatggc agatgactgg ccgccagttg gaattagcga tttttctaaa       600
     ataagtggcg atttatacca tgcgatttta gtgtatgaaa agccgagtag taaagtgaat       660
     tacgaaacag aaattttggt atcgtatccg ctttttgaaa aacgaattcc acttggaaat       720
     gtgcaaaata ttaaaattga agtttgggat gaagcgaagg agatttatag agttggtgta       780
     gccggggtgg attacggaac gattacatac gatgttggaa ctccatttgt aggcggtcct       840
     attttccaaa tgaattgtac tattccgttc aaagggattt ctactaaaac tcgtgttagt       900
     tttgatattg atacgaatgt ggacgggaaa cctggaacaa cagatccgta cttagttagt       960
     ctttcttccg tatcatcagc tacaaagtct ctggaattct atccagtgaa taatgctgtt      1020
     acgcaaatga cagctacctt ttttgggaaa gtaacgacgc gctttgagga tgagttaggc      1080
     aatccagtta cttttgataa ttatagtact gtaacaacac cagggaaagt caatcaagat      1140
     ggtaaatttg aaatagcgga acctttttta cacaattccg tccaaaacgt ggataaacac      1200
     gcctatgata cccttttgga tactaataaa tataaattat tagaggtaac ttctcctaat      1260
     aaactatctg aaacagcgga taatttaagt attcaaataa agcgtggtta tcagaatgat      1320
     gttttataca aaataaaagc tctccaaaaa cctgtcatta gcgcgcttcc tgaaatcgaa      1380
     tatagtaaaa cagtgaatag gaccatggaa gagtttttgg aagatgtgga agcaaaaaca      1440
     gatattccag ctgatataga ctgtgattta acgaatgtga aatggggtgt tccgggggat      1500
     tacctagttc ttataaccgc ggtgaatgag gataatcaag cagcggatcc tgttcctgta      1560
     acgattaaaa tttccaaaaa tcccgcacca gtcataacgg tagacccgga aataatctac      1620
     gataaaacag tgacgaaaga ggagagcaca ttactaaatg aagtaaatgc gcgaacaaat      1680
     gacggttcga cgataacttc taacattaac gataaagtaa aatggggcgt gccaggcgat      1740
     tacgaggtta ctttgaacgc ggtaaatgaa gacggcgtgg cagcggaatc gaaaacattt      1800
     atcgtccgca ttttaaaaag cccagcacca ataatcacgg tagatcctga aataacctat      1860
     ccgaaaacaa taactaaaac ggaagctgaa ctccttcaag aagtaaatgc gcaaacaaat      1920
     gatggttcac cgcttgtttc tgatatgaat gacaaagtaa aatggggcgt gccaggcgat      1980
     tatgaagtta cgttaaacgc gataaatgaa gacggcgtag cagcggaatc gaaaacattt      2040
     gtcgtccgca ttttaaaaag tccagcacca ataatcacgg tagatcctga aataacctat      2100
     gattcttctg taattaaaga cgaaagagag ctattaaaag atgtccatgc tcgttcaagt      2160
     gacggttcgg tattaacttc tgatagtcag gtaaaagtaa aatggaaaaa aacaggaagc      2220
     tataccgtta ctttaaatgc agtaaatgaa gatggcattt ctgctaattc tgtgcaattc      2280
     actgtgcata tagtagacgc taaagcaata ccagtagtaa ttgaagaaaa gcctgaatcc      2340
     actccaaaac cagatactaa agaaaaagta gttattaaga aagaaaaact accaaaaaca      2400
     ggagatacga atacaaaaac tatattgagt gggatttttt gtttaggcgc ttggtatttg      2460
     cttagaagaa aatag                                                       2475
//

If you have problems or comments...

PBIL Back to PBIL home page