(data stored in ACNUC10821 zone)

EMBL: AE017262.PE685

AE017262.PE685       Location/Qualifiers
FT   CDS_pept        712807..713478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0693.1"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to PIR:AB1110"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0693.1"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03475"
FT                   /protein_id="AAT03475.1"
FT                   /translation="MMVVKQMDDWSTLIGELEHNTPEKVWIVREELNISEVFEIQKLEA
FT                   HFILVLEGVLRMENEHQQILHYFRENNVIYQSPYELRVQNKLRLVAETPAHIVLLHREF
FT                   FLNYATNQPAYSEKLVRAIMDNAASFMFELMKNDLKSEDRLAYSLQQLCQSLELEVKNE
FT                   FYLLPHYINKNKLALYSDISRKSLYKYLQNLERKGQIKMNGNQILVRISRFTNSENVDW
FT                   L"
     ttgatggtgg tgaaacaaat ggacgactgg tcaactttga taggcgagct agaacataat        60
     accccagaaa aagtttggat tgttagagaa gaactaaaca tatcggaagt atttgaaata       120
     caaaaattag aggcgcattt tattttagtt ttagaaggtg tcttgcgtat ggaaaatgaa       180
     catcaacaaa ttctgcatta ttttagggag aataacgtca tatatcaatc tccatatgaa       240
     ttaagagtac aaaataaact aagactagtt gctgaaacac ctgctcacat tgttttactg       300
     caccgtgagt ttttccttaa ttatgcaaca aaccaacctg cttattctga aaaattagtg       360
     cgagcaatta tggataatgc cgcgagtttt atgtttgagt taatgaagaa tgaccttaaa       420
     tcagaggacc gattggctta ttcattacag cagctatgcc aaagtttaga attagaagta       480
     aaaaatgagt tttatctact gcctcattat attaataaga ataaattggc gctttatagt       540
     gatatttcga ggaaaagttt atacaaatac cttcaaaatt tagaaagaaa aggacaaatc       600
     aaaatgaatg gtaatcaaat acttgtccgc atttcgcgat tcacaaatag cgagaatgta       660
     gattggttgt ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page