(data stored in ACNUC10821 zone)

EMBL: AE017262.PE686

AE017262.PE686       Location/Qualifiers
FT   CDS_pept        713667..715283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0694"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM PF06458; match to protein
FT                   family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0694"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03476"
FT                   /protein_id="AAT03476.1"
FT                   /translation="MKLGKVGALLLGTALVFQAPFQVFATSVNGEEQVKKEAAAPKISV
FT                   NKQTLAATSDLEQTVGEAITKTIHLQDQALPNNEWGSYISDVKVTLSNMDGISYDVKYG
FT                   PLSEDGTHYQYADITLSGAPTKAGTGSISLEYYDGAGNGGVYSYSVNTKSKTTIQYVDG
FT                   DGNKLAEDTVKTGDLNTAYTSEPKTIDGYEVDETKLPSNQNGQFAETNQTVTYIYSKTK
FT                   SEVNKGTVGISFYTPDGSRRELKSSLDLSYAYPDGVPTDTVTFGDLAKNTTYKDLRNTP
FT                   DAPTLLWNDLLHYMVDYMNGDIDAAQFEEAVGLTPANFDLDFISRNFEGYKFDEAMYQE
FT                   NLSKLVTFEQDGDQVDLQVPFKKVEVGADITVKYVDTAGNELASVETLSGDVDDNYTSE
FT                   AKTIDGWTLKETPNNATGVFSKEAQTVTYVYEKNEDTDVTPAPDNSADTNDDNYSTDNT
FT                   ATTDDNSSSTVKEKAQTQASGPKEEKVTTQESTSNKVTTQPKESLPKTGDNVLESSLLL
FT                   GLGMLLLGGLFVFLRKTRKVK"
     atgaaattag gtaaagtagg agccttactt ctcggtacgg ctttagtttt ccaggcacca        60
     ttccaagttt tcgcaacgag tgtaaatgga gaagaacagg tgaaaaaaga agctgctgcg       120
     ccaaaaatat ccgttaacaa gcaaacctta gctgctacca gtgatttaga acaaacggta       180
     ggggaagcaa ttaccaaaac gatacatctt caagatcaag cattaccaaa caatgaatgg       240
     ggtagctata tttctgacgt gaaagtaaca ttatccaata tggacggaat tagttatgac       300
     gtgaaatacg gaccgctaag tgaagacggt acgcactatc aatatgcaga cataacactt       360
     tcaggagcac cgacaaaagc tggaacagga agcattagcc ttgaatatta cgacggggca       420
     ggtaacggtg gagtttacag ttattctgta aacacaaaat ctaaaacaac tatccaatat       480
     gtagatggtg atggaaataa attagcagag gatacagtga aaacgggtga tttaaataca       540
     gcctatacct ctgaacccaa aacgattgat ggatatgaag tagacgaaac aaaacttcct       600
     agcaatcaaa atggtcagtt tgctgaaaca aatcagacag ttacgtacat ctactcaaaa       660
     acgaaaagtg aagtaaataa aggaacggtc ggtatttcat tctatactcc tgatggtagc       720
     cgccgggaac ttaagtcctc attagactta agttatgcct acccagatgg tgtcccaaca       780
     gacacagtaa cattcggcga tttagcaaaa aatacgactt acaaagattt aagaaatacg       840
     cctgatgcgc ctactctttt atggaatgat ttgttacatt acatggtaga ctacatgaac       900
     ggcgatatag atgccgctca atttgaagag gcagttgggc taacaccagc gaattttgat       960
     ttagatttta tttcacgaaa tttcgaagga tataaatttg atgaagcaat gtatcaagaa      1020
     aatctaagta aattagtcac ttttgagcaa gatggcgatc aagttgattt gcaagtacca      1080
     tttaagaaag tagaagttgg agcggatatt actgtaaaat acgttgacac agcaggaaac      1140
     gaattagcat ctgtagaaac gttgagtggt gatgtggatg ataactatac ttcagaagca      1200
     aaaacaattg atggttggac tttaaaggaa acacctaata atgcaacagg agtctttagt      1260
     aaagaggcac aaacggttac gtatgtttat gaaaaaaatg aggatacaga tgtcacaccg      1320
     gctcctgaca attcagcgga tacaaatgat gacaactact cgacggataa tactgcgaca      1380
     acagatgata atagcagcag tacggtgaaa gaaaaggcgc aaacacaagc aagtggtcca      1440
     aaggaagaaa aagtaaccac acaagaaagt acttctaaca aagtaacaac acaaccaaaa      1500
     gaatctcttc ctaaaacggg agataacgtg ttggaaagta gcttgttact gggcttgggt      1560
     atgcttttgt tagggggatt atttgtattc cttcgtaaaa ctagaaaagt aaaataa         1617
//

If you have problems or comments...

PBIL Back to PBIL home page