(data stored in ACNUC10821 zone)

EMBL: AE017262.PE687

AE017262.PE687       Location/Qualifiers
FT   CDS_pept        complement(715369..715677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0695"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02627"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0695"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03477"
FT                   /protein_id="AAT03477.1"
FT                   /translation="MKVSKSFEAFAKEAPEVHSAWMETVHKLDAASKLDKKTEELAYIA
FT                   VMAATRLESGLPFHVKMAKTNGATRDEIISAVLVGLPAVGNTVISALPVALEAYDEV"
     atgaaagtaa gtaaatcatt tgaagcgttc gcgaaagaag ctcccgaagt acactctgcc        60
     tggatggaaa ccgtacataa actagatgcc gcaagtaaac tcgataaaaa aacagaagaa       120
     ctagcataca ttgctgtcat ggccgccact cgcctagaaa gcggactccc tttccatgtg       180
     aaaatggcaa agacaaacgg tgcgacgcgt gatgagatta ttagcgccgt tctcgttggt       240
     ctaccggctg taggaaatac tgttataagc gccctacctg ttgccttaga agcatatgat       300
     gaagtttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page