(data stored in ACNUC10821 zone)

EMBL: AE017262.PE689

AE017262.PE689       Location/Qualifiers
FT   CDS_pept        complement(716581..717447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0697"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0697"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03479"
FT                   /protein_id="AAT03479.1"
FT                   /translation="MIKVIASDMDGTLLNSDIEIAQENVEAIEKARAKGIHFVLCTGRM
FT                   YDDAMGLINKANLYAPAICMNGAEIRDEHGKIILQHPIDRNLARNTYNTLTELGMYTEF
FT                   FTDMGPITTDKARGKEFMIEMHKRIHPDVPAETIMDKVEERFESKDVHEIPDVERILGN
FT                   KDLTILKFISFSSDKDILAKAKQKLEKDSELSVTSSFSDNIEITHREAQKGISLQYYVE
FT                   KLGVTLDETFAIGDNMNDISMLKMAGYSVAMGNGEEEVKDLAEHVTLSNDEHGVAAAIY
FT                   KMLETND"
     atgattaaag ttattgcttc agacatggat ggcacactac ttaactctga tatcgagatt        60
     gcacaagaaa acgtcgaggc aatcgaaaaa gcccgcgcca aaggaattca tttcgttctt       120
     tgcaccggac gtatgtatga cgatgcaatg gggttaatta ataaagctaa tttatatgca       180
     ccagcaattt gtatgaatgg tgcggaaatc cgcgatgaac acggcaaaat aattttgcaa       240
     catccgatcg atagaaacct agcaagaaac acttacaaca cgctgactga attaggtatg       300
     tataccgaat ttttcactga catgggccca atcacaacag acaaagctcg tggcaaagaa       360
     tttatgattg aaatgcacaa acgcatccac ccagacgttc ccgcagaaac cattatggac       420
     aaagtagaag aacgttttga atcgaaggac gttcacgaaa ttccagatgt agaacgtatt       480
     ttaggcaata aagatttaac cattctaaaa ttcatttcct tctcttctga taaagacatt       540
     cttgcaaaag ccaaacaaaa actagaaaaa gattccgaac tatccgttac atcttctttc       600
     tctgataata ttgaaatcac tcaccgcgaa gcacaaaaag gtatttcttt acaatattac       660
     gtagaaaaat taggcgtaac acttgatgaa acttttgcaa ttggagataa tatgaatgat       720
     atttcgatgt taaaaatggc tggttatagt gtagctatgg gtaacggcga agaagaagtc       780
     aaagaccttg cagaacacgt aaccctttcg aatgatgagc acggcgttgc agcagccatc       840
     tataaaatgt tagaaacaaa tgactaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page