(data stored in ACNUC10821 zone)

EMBL: AE017262.PE69

AE017262.PE69        Location/Qualifiers
FT   CDS_pept        71118..72314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0053"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02859"
FT                   /protein_id="AAT02859.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAKRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYVKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
     atgaataaga caattgaaat ggacggaaca acttacgatt ttacttatga ggatctagtt        60
     tggagcatta cgtttccaaa atcaaaaaca cgcgctaaag aactcgcaca actagaacta       120
     ttagaaaaac ctgcgacaca ttttactcct gcaaaaatct caagtgatag cgattcgtat       180
     acaatttctt atgagattgc gaaacgtact tatggatttg aacaagttcg aaaaatggga       240
     cgtgaagata aactgcgcgc actgcggaat attgcggatt taggcgaatt gttaaacacg       300
     cgctatacat tctttttaca cccggataat ctgattttcg atattaactt agtgccaagt       360
     attgttcatc ggggcattaa aaatatatta ccgccttatg aactaacaga agaaactttt       420
     ttcaaacaat atcaatgttt cgttattgcg atgttttcta agaaattctc ttttgaaaac       480
     ttgtacaatg gctcgctatc aggggctaga ggaacgcaat ttgagaagag tatattagat       540
     gcaaaaacgg tgcaagatat tgctactatt ttagaagaag catacgtgaa agaacatgcg       600
     gcggttcaaa aaaatatggc aagcgtaccg aagaaaaaat acagtacttt ccgtgggttg       660
     gcggttggtt tcattatcgt cgctatttta cttgcaattc cagtaagtta ttttgccttc       720
     gttaaagtcc ctttacaaaa tgatttatta acagcaaacg agaatttcct gaaaacagat       780
     tacgataaag tgattacagg tctagaaaat gtggatccag aaaaaatgcc gcagtctgtc       840
     caatatgaat tagcttattc ctatgttaaa ggcgaaaaaa tgagcgataa aaagaaagaa       900
     aacattatga atacaatcag cttaaaatct gacgccaaaa acttacttta ctggatttac       960
     aatggtcgcg gagaatttag taaatcactt gatattgcca aacttttaga cgacccaacg      1020
     cttgcgatgt acagtttaac aaaacaaatt gaacaggtac aaagtgatac aacattaagc      1080
     ggcgatgaaa aagtggaaaa actaaaaact ttggaagaaa gcttgaaaga atacgatgaa      1140
     aaagtaaatg aatcaactac aactgaagat gaaacaacaa atacagaagc aaaataa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page