(data stored in ACNUC10821 zone)

EMBL: AE017262.PE690

AE017262.PE690       Location/Qualifiers
FT   CDS_pept        717621..718184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0698"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to OMNI:SP0074; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0698"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03480"
FT                   /protein_id="AAT03480.1"
FT                   /translation="MKTELEKMIAGEMYDPSDRELAHGRNRARKFCREINDAMDSESRA
FT                   SVLKRLFGGTKENVYVEPDFRVDYGSNIYVGENFYANFDCVILDVCEVHIGDNCMMAPG
FT                   VHIYTATHPLDPVERNSGLELGKPVEIGDNVWIGGRAIINPGVKLGNNVVVASGAVVTK
FT                   SFPDNVVLAGNPARVIKTIEVEEK"
     atgaaaacag aactagaaaa gatgattgca ggagaaatgt atgatcctag cgacagagag        60
     ctcgcacacg gaagaaatcg tgcacgtaag ttctgcagag agattaacga tgcgatggat       120
     tcagagtccc gtgcaagcgt gctgaagcgc ctattcggcg gaacaaaaga gaatgtatat       180
     gtggaacctg attttcgtgt tgattacggt tctaatatat atgtaggcga aaatttttat       240
     gctaattttg attgtgttat tttagatgtt tgcgaagtac atattggtga taattgtatg       300
     atggcgcctg gagttcatat ttatacggca acgcatccgc ttgatccagt agaacgtaat       360
     agtgggctag agcttggtaa accagttgaa attggcgata atgtttggat tggtggtcgg       420
     gcaattatta atccgggggt taagcttgga aataatgtcg tggttgcttc aggcgcagtt       480
     gtaacgaaaa gcttccccga taatgtcgtt cttgccggca acccagcacg cgttattaaa       540
     acaattgagg ttgaggaaaa atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page