(data stored in ACNUC10821 zone)

EMBL: AE017262.PE692

AE017262.PE692       Location/Qualifiers
FT   CDS_pept        718454..718831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0700"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04241"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0700"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03482"
FT                   /protein_id="AAT03482.1"
FT                   /translation="MKKTIITGAIFAGLAVLLGAFGAHALKDVLGSYASTWETGVQYQM
FT                   FHAGGILVVGLLMEKQASRLYTWAAILFSVGIVFFSGSLYVLSISKVSILGAITPIGGV
FT                   CFVVGWFLLILGVSRRTMSRY"
     atgaaaaaaa caattattac gggagccatt tttgcagggc tggcagtttt actaggggct        60
     tttggggcac atgctttaaa agacgtactt ggaagttatg cgagtacttg ggaaaccggc       120
     gttcagtacc aaatgtttca cgcaggaggc attttagttg tagggctatt gatggaaaaa       180
     caagctagtc ggctttacac atgggcagcg attttatttt cggtcggaat tgtctttttc       240
     tcgggtagtt tgtatgtgtt aagtatttct aaagtatcca ttttaggtgc gattacgcct       300
     atcggtggtg tttgctttgt cgttggttgg ttcttgctaa ttttaggagt atcaagaaga       360
     acgatgagta gatattaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page