(data stored in ACNUC10821 zone)

EMBL: AE017262.PE706

AE017262.PE706       Location/Qualifiers
FT   CDS_pept        727752..728798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0715"
FT                   /product="putative flagellar biosynthetic protein flhB"
FT                   /note="identified by similarity to SP:P35538; match to
FT                   protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0715"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03496"
FT                   /protein_id="AAT03496.1"
FT                   /translation="MAKDNKTEKATPRRIKKARNEGNVAKSKELNNAFSLLIVAGLLYF
FT                   FGEMFIKNTIQAFVALLKQPPKLANMESYSLFYLMEFGKVLMPIMVMVVIFGLMNYGVQ
FT                   VGILFSAKAVKPQFKRLNPANYFKRVFSVKGIVEVVKALLLITLLSYVAYIGFRDHLDT
FT                   LISYTGQNWLYSLGQIFALFKNEFLALFLVIAVIGLLDFFYQRYDYKKGLRMSKQEIKD
FT                   EMKDSEGRPEVKQRQRSIARGLLQGSITKKMADATFVVNNPTHISVVMRYDKTKDHAPK
FT                   LLVKGEDELALFIRQVADTDGVPMITNRQLARSIYYTTNPDEYIQEDLYKDVIEVMKEL
FT                   MDADKIKF"
     ttggcgaagg ataataagac ggaaaaagca acgccacgcc gcattaagaa agctcgaaat        60
     gaaggtaatg tggcgaaaag taaagaacta aataatgctt tttcactgct aattgtagct       120
     gggcttcttt atttttttgg agaaatgttt attaaaaaca cgattcaagc atttgttgct       180
     cttttgaaac agccaccgaa gcttgcgaac atggaaagtt acagtttgtt ttacttgatg       240
     gagtttggca aagtgttgat gccgattatg gtgatggttg tgatttttgg tttgatgaac       300
     tacggcgtgc aagtcgggat tttattttcc gcgaaagcag tgaaacctca gttcaaacga       360
     ctaaatccag cgaactactt taagcgagtg ttcagtgtga agggaattgt cgaggtggtg       420
     aaagcgctac ttttaattac gttgctttca tacgtggcgt atattggctt tcgggatcat       480
     ctagacacgc tcattagtta caccgggcaa aattggcttt actcactcgg acaaattttc       540
     gctttattca aaaatgaatt tctggcgctc ttccttgtaa tcgcagtaat agggctgctt       600
     gacttctttt accagcgtta tgactataaa aaaggcttgc ggatgtcgaa gcaagaaatt       660
     aaggacgaaa tgaaagattc agaaggtcga ccggaagtga aacagcgcca aagaagtatt       720
     gcgcgtgggc ttctccaagg ttcgattacg aaaaaaatgg cggacgcgac ttttgtggtg       780
     aacaacccga cacatatttc cgttgtgatg cgttatgaca aaacaaaaga tcatgcaccg       840
     aaattgctcg ttaaagggga agacgagctg gcactgttta ttcgtcaggt ggcggatacg       900
     gacggggtgc cgatgattac aaatagacaa ctggcacgaa gtatttacta tacgacgaat       960
     ccagatgaat acatacaaga agatttatat aaagatgtta ttgaagtgat gaaagaattg      1020
     atggacgcag acaaaatcaa gttctaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page