(data stored in ACNUC10821 zone)

EMBL: AE017262.PE71

AE017262.PE71        Location/Qualifiers
FT   CDS_pept        76841..77236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0073"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02861"
FT                   /protein_id="AAT02861.1"
FT                   /translation="MGLTDFWKTPTEKKRDEYDKLHDYLKDALKKHDEKMAEVKSDLSA
FT                   YKKGMPDMPSKGIPANPFVEKNEKVLEQLEKYIDKEKDKRASLKSAIDTAYRKYLEYKA
FT                   LAIKEEKAEQAKKEKEKKEREERLKNG"
     atgggtctaa cagatttctg gaaaacacct actgagaaaa aacgagatga atacgacaag        60
     ctacatgact atctaaaaga tgccctaaaa aaacatgatg aaaaaatggc agaagtaaaa       120
     agcgatttga gcgcgtataa aaaaggaatg ccagatatgc cgagcaaagg tattcctgca       180
     aatccatttg tagaaaaaaa tgagaaagtc ttagagcagc ttgaaaaata tatagataaa       240
     gaaaaagata aacgtgccag tttgaaaagt gccattgata cagcttatag aaaatattta       300
     gagtataaag cattggccat aaaagaagaa aaagcagagc aagcaaagaa agagaaggag       360
     aaaaaagaac gagaggagag gctaaagaat gggtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page