(data stored in ACNUC10821 zone)

EMBL: AE017262.PE711

AE017262.PE711       Location/Qualifiers
FT   CDS_pept        733783..734118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0688"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0720"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03501"
FT                   /protein_id="AAT03501.1"
FT                   /translation="MGRIENIKNLAFFEDKPGLAEQILMLEKKTQLFLPNEFEIRQTVG
FT                   YEIGDKEVILGRLESFYFLALKGVGEDNYRSQAFASEADAKAFFVHLPEMENELVAFWL
FT                   NEVELVR"
     atgggacgaa tagaaaacat taaaaattta gcgttttttg aggacaaacc tggactcgca        60
     gaacaaattc tcatgcttga aaagaaaaca caacttttct taccaaatga atttgaaatt       120
     agacaaacag ttggctatga aatcggggat aaagaagtta ttctaggccg actcgagtca       180
     ttttattttc tcgctttaaa aggtgtggga gaagataact accgctcgca agcatttgcc       240
     agtgaagcgg atgctaaagc gtttttcgtt catttaccag aaatggaaaa cgagttagtt       300
     gccttttggt taaatgaagt ggaattagtt cgctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page