(data stored in ACNUC10821 zone)

EMBL: AE017262.PE717

AE017262.PE717       Location/Qualifiers
FT   CDS_pept        739388..740251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0726"
FT                   /product="flagellin"
FT                   /note="identified by similarity to SP:Q05203; match to
FT                   protein family HMM PF00669; match to protein family HMM
FT                   PF00700"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0726"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03507"
FT                   /protein_id="AAT03507.1"
FT                   /translation="MKVNTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAG
FT                   LAVVTRMNVKSTGLDAASKNSSMGIDLLQTADSALSSMSSILQRMRQLAVQSSNGSFSD
FT                   EDRKQYTAEFGSLIKELDHVADTTNYNNIKLLDQTATGAATQVSIQASDKANDLINIDL
FT                   FNAKGLSAGTITLGSGSTVAGYSALSVADADSSQEATEAIDELINNISNGRALLGAGMS
FT                   RLSYNVSNVNNQSIATKASASSIEDADMAAEMSEMTKYKILTQTSISMLSQANQTPQML
FT                   TQLINS"
     atgaaagtaa atactaatat cattagcttg aaaacacaag aatatcttcg taaaaataac        60
     gaaggcatga ctcaagcgca agaacgtttg gcatctggta aacgtattaa cagttctctt       120
     gatgacgctg ctggtcttgc agttgttact cgtatgaacg ttaaatctac aggcttagat       180
     gcagcaagca aaaactcatc catgggtatt gacttgttac aaacagcgga ttcagctctt       240
     agctccatga gttcaatctt gcaacgtatg cgtcaattag cagtacaatc ttctaacggt       300
     tcattcagtg acgaagatcg taaacaatac actgctgaat tcggtagctt gatcaaagaa       360
     cttgatcacg ttgctgacac tactaactac aacaacatca aattactaga tcaaactgct       420
     acaggtgctg ctactcaagt aagcatccaa gcgtctgata aagctaatga cttaatcaat       480
     atcgatcttt tcaatgcgaa aggtctttct gctggaacaa tcactttagg tagtggttct       540
     acagttgctg gttatagtgc attatctgtt gctgatgctg attcttctca agaagcaacg       600
     gaagctattg atgaattaat caataacatc tctaacggtc gtgcacttct aggtgctggt       660
     atgagtcgcc ttagctacaa tgtatctaac gtgaacaacc aatccatcgc aactaaagca       720
     tctgcttcct ctattgaaga tgcagatatg gctgctgaaa tgtccgaaat gactaaatac       780
     aaaattctta cacaaacatc tatcagcatg ctttctcaag caaaccaaac accgcaaatg       840
     ttaactcaat taattaacag ctaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page