(data stored in ACNUC10821 zone)

EMBL: AE017262.PE720

AE017262.PE720       Location/Qualifiers
FT   CDS_pept        742774..743073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0729"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by match to protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0729"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03510"
FT                   /protein_id="AAT03510.1"
FT                   /translation="MEQVFQVELPEWEPKEPSQEGREKGSIRQVDNIGVNLIVRLGKKE
FT                   MPVGDIAELSIGDVLEVEKKPGHKVEIFLDEKKVGIGEAILMDENFGIVISEID"
     atggaacaag tatttcaagt agaacttcct gaatgggaac cgaaagaacc gagccaagaa        60
     ggacgcgaaa aaggctctat ccgccaagta gacaatattg gcgttaactt aatcgtccgc       120
     cttggaaaaa aagaaatgcc agtaggggat atcgccgagc taagcattgg cgatgtcctc       180
     gaagtggaaa agaaacctgg ccacaaagtc gaaattttcc tcgatgaaaa gaaagtcggc       240
     atcggtgaag ctattttgat ggacgagaac ttcggaatcg ttatttcaga aatcgactaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page