(data stored in ACNUC10821 zone)

EMBL: AE017262.PE724

AE017262.PE724       Location/Qualifiers
FT   CDS_pept        745008..746243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0733"
FT                   /product="putative flagellar hook protein FlgE"
FT                   /note="identified by similarity to SP:P75937; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429; match to protein family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0733"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03514"
FT                   /protein_id="AAT03514.1"
FT                   /translation="MNQTMYTAISGMNAFQQALSVTSNNIANANTTGYKKQSVVFNDLL
FT                   YQNTMGSVAGGLYAGTNPMSFGSGSKIGAILTDYTAGSPTATGRNKDAALQGRGFFIAG
FT                   DNAGGNIVYTRDGSFAVSDNNYLTTQQGKYVMGYATDKNGNVLNGNLQPIQIPLNSAIP
FT                   GEATKNGSLSGNIPLDWGEKDTISSELSVYDNAGGKHKLQVNMKAATPDASGNVSYEYE
FT                   IQMDGKALTPPVTGTLNYNAQGELTNPDALKNIQINSTVNGKQVNMGLNLSGLTNYGTN
FT                   QVFSPTSDGKGAATVKDYAVTDSGYIAVSYSDGTVIPVAQLAVATFSNEDGLVKMGNGE
FT                   YVPGLSSGDAVYGVAGQNGAGGISGSSLEGSNVDLSREFVNLMTYQSGFQGNTKVIRVA
FT                   DDVMKQIVNLIQ"
     atgaatcaaa ctatgtatac agctatttct gggatgaatg cgttccaaca agcattatcg        60
     gtaacatcaa ataatattgc caatgccaac acgacaggat acaaaaaaca aagcgtcgtt       120
     ttcaatgatt tactttacca aaacacaatg ggatctgttg caggcggact ttatgctgga       180
     acaaacccaa tgagtttcgg ttccggttca aaaattggag cgattttaac cgattataca       240
     gcgggttccc caacagcaac gggcagaaat aaagatgcag cactacaagg tcgcggcttt       300
     ttcatcgcgg gcgataatgc agggggcaat atcgtttaca cgcgtgacgg gagcttcgcc       360
     gtttccgaca acaattattt aactacccaa caagggaaat acgtaatggg ttacgcaaca       420
     gacaaaaatg gcaacgtttt aaacggtaat ttgcaaccaa ttcaaatccc gctaaatagc       480
     gcaattccag gagaagcaac aaaaaacggt agcttaagcg gtaacattcc actagactgg       540
     ggcgaaaaag atacgatttc ttccgagctt tctgtatatg ataatgctgg cggaaaacat       600
     aaacttcaag tgaatatgaa agctgctaca ccagatgcga gcggtaatgt ttcctacgaa       660
     tatgaaattc aaatggacgg aaaagcatta actcctccag taacaggaac acttaattac       720
     aatgcgcagg gcgaattaac aaacccagac gcacttaaaa atatccaaat caattccaca       780
     gtaaacggca aacaagtcaa tatgggctta aacctaagtg gcttaaccaa ctacggaaca       840
     aaccaagtat tctcaccaac ttctgacggt aaaggcgctg cgactgtaaa agattatgca       900
     gttaccgatt ctggctatat tgcagtgagt tactcagatg gtacagttat cccagttgcc       960
     caacttgcgg tggctacttt ctccaatgaa gacggcttag tcaaaatggg gaacggcgaa      1020
     tatgttccag gattatcttc tggcgatgca gtatacggcg ttgctggcca aaatggcgct      1080
     ggcggaatta gcggttcttc tctagaaggt tcaaacgtag acttgtcccg cgaattcgtt      1140
     aacttaatga cataccaaag tggtttccaa gggaatacaa aagttattcg tgtggcggat      1200
     gacgtgatga aacaaattgt gaacttgatt cagtag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page