(data stored in ACNUC10821 zone)

EMBL: AE017262.PE727

AE017262.PE727       Location/Qualifiers
FT   CDS_pept        747542..749056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0736"
FT                   /product="flagellar motor switch domain protein"
FT                   /note="identified by similarity to GP:7009585; match to
FT                   protein family HMM PF01052; match to protein family HMM
FT                   PF04509"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0736"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03517"
FT                   /protein_id="AAT03517.1"
FT                   /translation="MELDVIGEIANISFGSASTVLSDLLHQQVTISTPKVEIVDLYNTK
FT                   DIDIPHVVLEVNFHKGIEMRNLFVLQSEVAAAIADLMMMGDGNIDPNEELSELHLSAVQ
FT                   EAMNQMMGHSATAMSNMFGEMIDITTPDIKVIALKEQLEDTNDQTMIKVGFDLIIGDLI
FT                   TSNLMQLIPIDKGHELAKRLLGDAVPEPEPVKEEISLTAEELDVFLEVCNIGIGSASTV
FT                   LSKLLNRKVSLQIPTARVIDSKEFEFNERPCLVTSVEFVEGLRSSNTFIISKNAALIMA
FT                   DLMMMGDGLVQEDAELTELEVSAVQELMNQMMGFSATAMSEMLGTKIDISPPTMEFCNF
FT                   GDTMIQKNIEEGKTVEVIFPLEVEGLLKTPMYQIFNPAAAKEMAQLMLGIQAKEVAEKE
FT                   ATTPAEIIEPEKLAEPVHQAVIEEKETLSEMEQILEDIPVTLEVVFGTAKVKLEKFISW
FT                   CEKDVIILKESMNEPLVLALNGVTIGKGILVRVDDHFGIQMTELVR"
     atggaactag atgtgatagg agaaatcgcc aatatttcgt ttggctcagc ttctacggtc        60
     ttatctgatt tactacacca acaagtcacc atttcgacgc caaaagttga gattgttgat       120
     ttatataata cgaaagacat tgatattcca catgtcgtgt tagaagtgaa ttttcacaaa       180
     ggaatcgaaa tgcggaattt atttgttcta caatcagaag tggctgcggc tatcgcggac       240
     ttaatgatga tgggtgatgg aaacattgat ccgaatgaag aactttcaga acttcatcta       300
     agcgccgtac aagaagcgat gaaccaaatg atgggacatt ccgccactgc aatgagcaat       360
     atgtttggcg aaatgattga tattacgaca ccagacatta aagtaatcgc gctaaaagaa       420
     caattagaag atacgaacga ccaaacaatg ataaaagtcg gctttgactt aattatcggc       480
     gacttgatca catcgaattt aatgcaactc atccctattg ataaagggca tgaacttgca       540
     aaaagattac ttggcgacgc agttccagag ccagaaccag taaaagaaga aatcagctta       600
     acggccgaag agttagatgt ctttttagaa gtatgtaata tcggcatcgg ttcagcttca       660
     accgttctat ccaaattgct taaccgtaaa gtttccttac aaatcccaac tgcacgcgta       720
     attgatagca aagagttcga gtttaatgaa cgtccttgct tagtgacgag tgtggaattt       780
     gtcgaagggc tgcgctcaag caacacattt atcattagca aaaatgccgc gctaattatg       840
     gcagatttaa tgatgatggg agacggtttg gttcaagaag atgcagaact gacggaactt       900
     gaagtcagcg cagtgcaaga attaatgaac cagatgatgg gcttctcagc gacagcaatg       960
     tcagaaatgc tcggaacaaa aatcgatatt agcccaccta caatggaatt ttgtaatttc      1020
     ggcgatacga tgattcaaaa aaacattgaa gaaggaaaaa ctgtcgaagt catcttcccg      1080
     ctagaagtag aaggactatt aaaaacgcca atgtaccaaa tttttaatcc agcagcagca      1140
     aaagaaatgg cgcaattgat gcttgggatt caggcgaaag aagtcgcaga gaaagaagcg      1200
     acgactccag cagaaataat cgaaccagaa aaactagctg aaccagtgca ccaagcagtt      1260
     atcgaagaaa aagaaacact ttccgaaatg gaacaaattt tggaagatat tcccgtaacg      1320
     cttgaagtgg tattcggaac agcaaaagta aaactcgaaa aatttatctc ttggtgtgaa      1380
     aaagatgtga ttatcctaaa agagagtatg aacgaaccac ttgtcttagc gctaaatggc      1440
     gtgacgattg gtaaaggaat tttagttcgc gtggatgatc attttggtat acaaatgacg      1500
     gagttagtaa ggtga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page