(data stored in ACNUC10821 zone)

EMBL: AE017262.PE73

AE017262.PE73        Location/Qualifiers
FT   CDS_pept        77525..78226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0057"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02863"
FT                   /protein_id="AAT02863.1"
FT                   /translation="MTVETIDVFSPVELYLLLSPIEAQHLFGVPDKLTFLLKGEDVFAE
FT                   GFDRLKGKGILNDAGELTDGGGFLIDSLIEYYQSKKYVRMNQLMFAFPEKTPNELLVMI
FT                   EITPQKEYRFERMNKIYALEMIKDFFPLIRREPGERETEFLKEELTNEERKRATAFDPE
FT                   KNFISMEFFHVDEEPKEKNNAKYYKQYLAFEMEDKLMMIDVVNDTYYRGSQYALLKLLF
FT                   DELEFPYEEAK"
     atgacagtgg aaacgataga cgtattttcc cctgttgagt tatacctttt actttctcca        60
     atcgaggcgc aacacttatt tggtgttcct gacaagctta cttttttatt aaagggagaa       120
     gatgtttttg ctgaagggtt tgaccggctc aagggtaaag ggattttaaa tgatgcaggc       180
     gagctaacgg atggcggcgg ctttttgatt gattccttaa ttgaatatta tcaaagtaaa       240
     aagtatgtgc gtatgaacca gttgatgttt gcttttccag aaaaaacacc caatgaacta       300
     cttgtaatga ttgagataac ccctcaaaaa gaatatcgat ttgaacgaat gaataaaatt       360
     tatgcgctag aaatgataaa agatttcttt ccgctcattc gtagagaacc tggtgaaaga       420
     gagactgagt ttctaaaaga agagttgact aatgaagagc gtaaacgagc aactgctttt       480
     gatccggaga aaaattttat tagtatggaa ttctttcatg tggatgagga accaaaagaa       540
     aaaaacaatg ctaaatatta caaacagtac ttggcatttg agatggaaga caaattaatg       600
     atgatagatg ttgtaaacga tacctattac cgtggaagtc agtatgcttt attaaaatta       660
     ttgtttgatg aacttgaatt tccttatgag gaggctaaat ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page