(data stored in ACNUC10821 zone)

EMBL: AE017262.PE730

AE017262.PE730       Location/Qualifiers
FT   CDS_pept        751761..752225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0707"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0739"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03520"
FT                   /protein_id="AAT03520.1"
FT                   /translation="MNNVSIGQISQSKQTNVVRGMQELNQTQQLYFEQMKANGKKQTPS
FT                   LTEINELITNVTDKKSLVEMDMTVDNVLSYKKAVQTFLNFYVNNVMDYDNIESRHPKYG
FT                   FSQKMTILKQVEKQTNELDDVMNLIDTKTGHLDMLNRIGEITGMILDVVL"
     atgaataatg tttcaattgg ccaaatttcg cagtccaaac agacgaatgt agttagggga        60
     atgcaagaat taaatcaaac acaacagctt tattttgaac aaatgaaggc aaatggcaag       120
     aaacaaactc cttccctgac tgaaattaac gaactaatca cgaatgtcac agataaaaag       180
     tcactcgttg aaatggatat gacggtagat aatgttttga gctataaaaa agcagtccaa       240
     acatttttga atttttatgt gaataatgtg atggattacg acaatatcga aagccgtcat       300
     ccaaaatacg ggttttcgca aaaaatgacg attttaaagc aagtagaaaa acaaaccaat       360
     gaactcgatg atgtaatgaa tttaattgat acaaaaactg gacatttaga catgctaaac       420
     cgtattggtg agattactgg catgattctc gatgtcgtat tgtag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page