(data stored in ACNUC10821 zone)

EMBL: AE017262.PE731

AE017262.PE731       Location/Qualifiers
FT   CDS_pept        752235..752663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0740"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0708"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0740"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03521"
FT                   /protein_id="AAT03521.1"
FT                   /translation="MQNELINQLEILIEKNVKATDAAILLGKLVQEENWIEAEECQLGL
FT                   QRELAALQNEYQALKTIIGEDNTLRTLQNTWTPAENAIIDERKKMLLEKENLLRVSVTE
FT                   NQIRTEMQLAFSEHMVDVITGHHAETQAENNMMINETF"
     atgcaaaacg aattaatcaa tcaattagaa attttaatcg aaaaaaatgt caaagcgacc        60
     gatgcagcaa ttttactcgg aaaattagtg caagaagaga actggattga agcagaagaa       120
     tgccaactag gactacagcg cgaacttgcc gctttgcaaa acgaatatca agctttaaaa       180
     acaatcattg gcgaagataa tacgcttaga acgctccaaa atacttggac acctgcggaa       240
     aatgccatta tagatgaacg gaaaaaaatg ctacttgaaa aagaaaacct tttacgagta       300
     agtgttacgg aaaaccaaat tagaacagaa atgcaattgg ctttttcgga acatatggtg       360
     gatgttatta cgggacatca cgcggaaaca caagcagaaa ataatatgat gataaacgag       420
     actttttaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page