(data stored in ACNUC10821 zone)

EMBL: AE017262.PE735

AE017262.PE735       Location/Qualifiers
FT   CDS_pept        756410..756796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0744"
FT                   /product="putative flagellar protein FliS"
FT                   /note="identified by similarity to SP:P39739"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0744"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03525"
FT                   /protein_id="AAT03525.1"
FT                   /translation="MQAWKRYTQNELNTSNPIKNTIYIYERCIIEFKKLDKALEQLHFS
FT                   EADLILDKMEKIFEELKLQLNPEAGQELYDNIFGLYEWISEQIRQMQLLKQPVNIDTII
FT                   HVITQLKEGYEGVMKHESSKDTFG"
     atgcaagctt ggaaacgata cacgcaaaat gaattaaata cgagcaaccc cattaaaaac        60
     accatttata tatacgaacg ttgtattatt gaatttaaaa aattggacaa agcactcgaa       120
     caactacatt tttccgaagc cgatcttatt cttgataaaa tggaaaaaat ctttgaagaa       180
     ttaaaattac aattaaatcc agaagccggg caagaacttt acgataacat tttcggctta       240
     tatgaatgga tttctgaaca aattcgccaa atgcaactac taaaacaacc cgttaatatt       300
     gatacgatca ttcatgttat cacgcagctt aaagaaggct acgagggagt gatgaaacat       360
     gaatcaagca aagacacatt tggctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page