(data stored in ACNUC10821 zone)

EMBL: AE017262.PE74

AE017262.PE74        Location/Qualifiers
FT   CDS_pept        78227..78559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0058"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02864"
FT                   /protein_id="AAT02864.1"
FT                   /translation="MAQQTMGGAGAASTIDINPDEMTHIAKELLAIANEFEGVIKPAVN
FT                   QLKANKYLTKGKAKKAMDKVPKANERVMELQDQYNMASSVVFDILQTMVDADRDIAEKI
FT                   IAALEV"
     atggcacaac aaacgatggg cggtgcagga gccgcttcta caatagatat taatccagat        60
     gaaatgactc atattgccaa ggaattacta gcaattgcta atgagtttga aggagtaata       120
     aagccagcag taaatcagtt aaaagcaaat aagtatttaa caaaaggcaa agcaaaaaaa       180
     gcaatggata aagtacctaa agcgaatgaa cgtgtaatgg aacttcaaga tcaatacaat       240
     atggcttcct ctgttgtgtt tgatatactc caaaccatgg ttgatgcaga cagagatatt       300
     gctgaaaaaa ttatcgcagc tttagaggta tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page