(data stored in ACNUC10821 zone)

EMBL: AE017262.PE742

AE017262.PE742       Location/Qualifiers
FT   CDS_pept        761022..761714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0751"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0751"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03532"
FT                   /protein_id="AAT03532.1"
FT                   /translation="MSLSNPRIPKGKVTLSDVKMELFYLDDIEETEEVESPYSKELEQL
FT                   ESHQKELEKHLSAIEIEQQKLANEKAALQAERQAIEELKREAETEIEANKQAFEKEKTQ
FT                   MYLTITDFLWDESIDLAERIVHQAIDTRQIEVLPMLTEVIQKLPVAFDKLNVTTHPETL
FT                   KALKEENTGTKYDWLLENIHWNFDMRLDYGEFTVEEEKEYFDYRITEIFQTLHKQNAER
FT                   KILGGDKP"
     atgtccttat ctaatccgcg aatcccaaaa ggtaaagtca ctttatccga cgtgaaaatg        60
     gaactgtttt atttggatga tatagaagaa acagaagaag tcgagtcacc ctactcgaaa       120
     gaacttgaac aactagaaag tcatcaaaaa gaactggaaa aacacctatc tgccatcgaa       180
     atcgaacagc aaaaattagc taacgaaaaa gcagcacttc aagctgaacg ccaagccatt       240
     gaagaattaa aacgcgaagc tgaaacagaa atcgaagcaa acaaacaagc ttttgaaaaa       300
     gaaaaaacac aaatgtatct aactatcacc gatttccttt gggatgaaag tatcgatctt       360
     gcagaaagaa tcgtccacca agcaatcgac acgcgccaaa tcgaagtctt accaatgcta       420
     actgaagtca ttcaaaaact cccagttgct ttcgacaaac taaacgtcac cacccatcca       480
     gagaccttaa aagctctaaa agaagaaaac acaggcacaa aatacgactg gcttttagaa       540
     aatatccatt ggaacttcga tatgcgactc gattacggcg aatttactgt agaagaagaa       600
     aaggaatact tcgactaccg catcaccgaa attttccaaa cacttcataa acaaaacgcc       660
     gaacggaaaa ttctaggagg cgataaaccg tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page