(data stored in ACNUC10821 zone)

EMBL: AE017262.PE75

AE017262.PE75        Location/Qualifiers
FT   CDS_pept        78573..80249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02865"
FT                   /protein_id="AAT02865.1"
FT                   /translation="MKEVNYREDDWREAKSALAPFAAANWVGGLFNNLEKVSKNMEEAE
FT                   EDIQELDSDHAISFQHTNYRGKYSAIEDDLMVLYKFSCHAGEKMETLVDQPFYEKLDAF
FT                   VDGMQDLSISTYSTTNRIGAKSKQTYMSSYGNQPQVIESVKDNATIEDLMNGDNFYANQ
FT                   MQLQYRDWQRANPDQDVSKKDFQMGMLHSRAFEYKSIKDEQQEKEFWVNIVATVVIVGV
FT                   SIFCPPAGLALAVGYGSLEAGSAISGKDWVSGRELSAEERALRGGLALLDIVPGVKALS
FT                   TGAKAASAGSKLVRVGDNVLAGSKNVGKGTIDNGIQAGKQAMDLRLANAKKVSEAVQKK
FT                   LTKDLDEIGTMAKTIQNKTKETFTLPPREKLAFAGGGSIPEQSATGAASIAAKKKLKDM
FT                   MQNMDNLNVKGGGESGTIEKIGKTNELKSPSSIARSWQGGGKYPGVDDYEDIVLKVGDV
FT                   IYRGEPNGSEYFTTKEVIENADISATKIFEGLQVEKHPIYGYRKSMTGYKVNSEVDAAS
FT                   GFTKANPQFGEGGALQVFVPNVNELIEKGILIPIDEIKLID"
     atgaaggaag tcaactaccg agaagacgac tggcgtgaag ccaaaagtgc cctcgcccca        60
     tttgccgcag cgaattgggt aggcggttta ttcaataatt tagaaaaagt atcgaaaaat       120
     atggaagaag cggaagaaga tatccaagag ttggactcag accacgcgat ttcgtttcaa       180
     cacaccaact atcgtggaaa gtacagcgct atcgaagacg atttgatggt attgtataag       240
     tttagttgtc atgcagggga aaagatggaa accctggtag accaaccttt ttacgagaag       300
     ttggacgcgt ttgtggatgg catgcaagat ttgagtattt cgacgtattc taccaccaac       360
     cggattggtg cgaagtcgaa acaaacgtac atgtcttctt acggcaatca gccacaagta       420
     attgaatccg tgaaagacaa tgcgacgatc gaagacttga tgaatggcga taacttctac       480
     gcaaaccaaa tgcaactaca atacagggac tggcaacgag cgaatccaga tcaagatgtg       540
     agtaagaaag actttcaaat gggaatgtta catagtcggg catttgaata taaatcgatt       600
     aaagatgaac aacaagagaa agaattttgg gtcaacattg tggcaaccgt ggtgattgtg       660
     ggtgtcagta ttttctgccc accagccggc cttgccttag ccgtaggata cgggagttta       720
     gaagctggtt cggcgataag cgggaaggac tgggtatctg gccgagaact aagtgcggaa       780
     gaacgagcgc ttcgtggtgg tttagcactg ctagatatcg ttccaggtgt gaaagcattg       840
     agcacaggag cgaaagctgc cagtgccggc tcgaaacttg tccgcgtagg cgataatgtt       900
     ttagcaggta gcaagaacgt cggcaaagga accatcgaca atgggattca agcagggaaa       960
     caagcgatgg atctccggtt ggccaatgcg aaaaaagtca gcgaagccgt ccaaaagaaa      1020
     ctcaccaaag acctcgacga gatcggcacg atggctaaga ccatccaaaa caaaaccaaa      1080
     gaaaccttca cacttccacc gcgtgagaaa ctcgcctttg cgggaggagg cagtatcccg      1140
     gaacaaagcg ccactggagc cgcctccata gctgcgaaga aaaagctgaa agatatgatg      1200
     cagaacatgg ataatttgaa tgtgaagggc ggcggagaga gtggtacaat agaaaaaatc      1260
     ggtaaaacta atgaactgaa aagcccatcg tcaattgcaa ggagttggca agggggcggt      1320
     aaatatccag gagtggatga ctatgaggac attgtattga aagtggggga tgtcatttac      1380
     agaggagagc caaatggatc agaatacttt accactaagg aagtcataga aaatgctgat      1440
     attagtgcga ctaaaatttt tgaaggatta caagtcgaaa aacatcctat ttatggctat      1500
     cggaaaagta tgacaggata taaagtgaat agtgaagttg atgcagcatc tggatttacg      1560
     aaagctaatc cacaatttgg tgagggtgga gcacttcaag tttttgttcc aaatgtaaat      1620
     gaattaatag aaaaaggcat tttaatacct attgatgaga taaaattaat tgattga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page