(data stored in ACNUC10821 zone)

EMBL: AE017262.PE750

AE017262.PE750       Location/Qualifiers
FT   CDS_pept        767976..769781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0759"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by similarity to SP:P39216; match to
FT                   protein family HMM PF00015; match to protein family HMM
FT                   PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0759"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03540"
FT                   /protein_id="AAT03540.1"
FT                   /translation="MNLIKNRKLKTKLSINIVITTIMLIGLGATSFLGFRHVATLSDNM
FT                   VDNNVAPMKEIAKIQTNMAQINIDILTMFDTINGKSALIKDIDDLYAENDQAIHNFKKA
FT                   NLTAEDKKQLAYFEEKLADMKSSASSVISDTSSALDDAELLGAQNRYYQNVKTKFDDAT
FT                   KQLNVLNEMNYKEVENSSQAISDFGVKISIIFTAVIIAVLISLFIFNAYITRVILKGIR
FT                   HLQTAVHKVASGDLSYRSTYNGRDELGDITNDLNEMSENLRLMIEDVKKASTDVKSSSD
FT                   NVIISSEIISAMTTEMDIEMKMMGEQIQTQIGSMKESTDAMDQMTGGVQNVAEYALKVS
FT                   DLTKDSAEKTNDGIAVINNLVSQMDRISGVMRSSTDVVSQLVNRVGEVEKALDTVTNIA
FT                   DQTNLLALNAAIESARAGEHGRGFAVVAEEVRKLAEQSRLAVVDINTVLKKIQTESKTT
FT                   IEVMNTGLSESEAGQKIISETEATFTDLLNRVNDISAQMQNVSQETEEMAAGIEEVNTS
FT                   ISDVTEISNQIGEKSTAALEFAEVNKMKVDELVVISEEMQKISGSLEGYIANFNTEVSE
FT                   EAVEVTEEPESETKDPGEPVLAENV"
     gtgaatttaa ttaaaaatcg taaattgaaa acaaaattaa gcatcaatat tgttataacg        60
     accatcatgt taatcggact tggcgcgact agctttcttg gctttcgtca tgtagcaaca       120
     ctttcagata atatggttga taataatgtc gcaccgatga aagaaatcgc aaaaatccaa       180
     acaaacatgg cgcaaatcaa tatcgacatc ctgaccatgt tcgacactat taacggaaaa       240
     tcagctctta taaaagatat tgatgatctt tatgccgaaa atgaccaagc aattcataat       300
     ttcaaaaaag ccaatttaac agcagaagat aaaaaacaat tagcgtactt tgaagaaaaa       360
     ctagcggaca tgaaatcatc cgcatcctca gtaatcagtg acacatcaag cgcactagac       420
     gacgcagaac tacttggagc gcaaaacaga tactaccaaa acgtcaaaac aaaatttgac       480
     gatgcaacta aacaattaaa cgttttaaat gaaatgaact acaaagaagt cgaaaattct       540
     tctcaagcaa tttctgactt tggtgtaaaa atcagtatca ttttcacagc agttattatt       600
     gccgtgctaa tttctctatt catttttaat gcttatatta caagagtgat tctaaaagga       660
     atccgtcact tgcaaacagc tgtacataaa gtagctagtg gagatttgtc gtaccgcagc       720
     acttataacg gtagagacga gcttggtgat attacaaacg acttgaatga aatgagcgaa       780
     aacctaagat taatgattga agacgttaaa aaagcttcta cagacgttaa atcttccagt       840
     gataacgtta ttattagttc ggaaattatt tctgcaatga cgacagaaat ggacatcgaa       900
     atgaaaatga tgggtgagca aatccaaaca caaatcggca gcatgaaaga aagcacggat       960
     gcaatggatc aaatgactgg cggcgttcaa aatgtggctg aatacgcgct taaagtatct      1020
     gacctaacaa aagattccgc agaaaaaacg aacgatggca ttgccgttat caataatctc      1080
     gtgtcccaaa tggaccgtat cagtggcgtt atgcgttcaa gtacagacgt tgtttctcaa      1140
     ttagttaacc gcgttggtga agtggaaaaa gcgctggata ccgttacaaa tatcgctgac      1200
     caaaccaact tgcttgccct aaatgcggca atcgaatctg ctcgtgctgg tgaacatggc      1260
     cgtggatttg cagtcgtagc cgaagaagtc cgcaaactag ctgaacaatc acgacttgct      1320
     gttgttgaca ttaatactgt tctgaaaaaa attcaaacag aatcaaaaac tactatcgaa      1380
     gtaatgaaca caggtctttc cgaatcagaa gctggccaaa aaatcatttc tgaaacggaa      1440
     gcaactttca cagacttact caatcgtgtc aatgatattt ccgctcaaat gcaaaatgta      1500
     tctcaagaaa ccgaagaaat ggctgcggga attgaagaag tcaacacgtc aattagcgac      1560
     gtaacagaaa tttccaatca aatcggtgaa aaatccactg ctgcacttga attcgcagaa      1620
     gtaaacaaaa tgaaagtgga cgagctagtt gttatctccg aagaaatgca aaaaatttcc      1680
     ggttcattag aagggtatat cgccaacttc aataccgaag tgagcgaaga agcggtcgaa      1740
     gtaacagaag agccagaatc agaaacaaaa gatccaggag agccagtcct agcagaaaat      1800
     gtctag                                                                 1806
//

If you have problems or comments...

PBIL Back to PBIL home page