(data stored in ACNUC10821 zone)

EMBL: AE017262.PE751

AE017262.PE751       Location/Qualifiers
FT   CDS_pept        769794..770522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0760"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0728"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0760"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03541"
FT                   /protein_id="AAT03541.1"
FT                   /translation="MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYKLDN
FT                   EPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFNGKRVTKNELANNLPTTPIEQNGL
FT                   HGNPDKAFVGSISGDSPGLGVNHAPIANLAAKYVNEAHVHDISGNSIQDIITVLSTGAP
FT                   VWIITTTDYHAPKNWQTVQTKEGKKKITYSMHSVVITGFDKDNFYINDPYGHKNRAVKR
FT                   SVLEEGWSAMGKQAIYLSHP"
     atgcgaattt ggataaaatc actgcttgtc attacagcgt gtatatttag tttgaccctt        60
     ctaaatacga aatatacctt ttattcacca accgtcaaac tcgaaagcgc caaagtcgtt       120
     tataaattag acaacgaacc ttttaatgta agattagatg tgccactagt gaatcaaatg       180
     gatgctccta cgctttttaa tggctgcgaa gtaacgagtt tagcaatgct cttacaattc       240
     aatggaaagc gtgtaacgaa aaatgagtta gcgaataatc tcccaacaac accaatcgaa       300
     caaaatggtt tacacggtaa tccggataaa gcatttgttg ggagcattag cggcgatagc       360
     cctggtctag gcgtgaatca tgctcccata gctaatctgg ctgctaaata cgttaatgaa       420
     gcacacgtcc acgatattag cgggaatagc attcaagaca tcattactgt actcagcaca       480
     ggcgcaccag tatggattat cactaccacc gactaccatg cacccaaaaa ctggcaaacc       540
     gtccaaacaa aagaaggtaa aaagaaaatc acgtattcga tgcacagtgt ggtaattacc       600
     gggttcgata aagacaattt ttatattaat gacccatatg gacataaaaa ccgtgccgta       660
     aaaagaagtg tacttgaaga aggctggtct gctatgggca agcaagccat ttacctaagt       720
     cacccataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page