(data stored in ACNUC10821 zone)

EMBL: AE017262.PE76

AE017262.PE76        Location/Qualifiers
FT   CDS_pept        80262..80651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0063"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02866"
FT                   /protein_id="AAT02866.1"
FT                   /translation="MLNTVNGELKINDELIVHPEYQFDEFKNTEYYDGQDGIKIIYLEK
FT                   IQKIDTYHYFVNLFFKEKQLYSVSLINCDQNISESNEIDRKTIHDKILSENGIQNNVSY
FT                   NWGKIISEYDPRSNISSIDIFYNIR"
     atgttaaata ctgtaaatgg agaattgaag ataaatgatg aattgattgt tcatcctgaa        60
     tatcaatttg atgaatttaa gaacacagag tattatgatg gacaagacgg gattaaaata       120
     atttatctgg agaaaataca aaaaattgat acgtatcatt actttgtaaa cttatttttt       180
     aaagaaaagc aattatatag tgtttctctt attaattgtg atcaaaacat ttctgaatct       240
     aatgaaatag ataggaaaac aatacacgat aaaatattaa gtgagaacgg tattcaaaat       300
     aatgtaagtt ataattgggg aaaaataatt tctgaatatg atccaagaag taatataagt       360
     agtatagata ttttttataa tataaggtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page