(data stored in ACNUC10821 zone)

EMBL: AE017262.PE77

AE017262.PE77        Location/Qualifiers
FT   CDS_pept        80789..81199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0064"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02867"
FT                   /protein_id="AAT02867.1"
FT                   /translation="MSTKFAKYKEVIYKVSKIGDNTVRLVSSNEQDIQKGFVKKEYPDN
FT                   YLNKEKLPDLYICEVDFSCIKELYEISDIVVYKEKEFESITETKDFFRIGTINTEIAKE
FT                   LNFERTDKYYYEKWVPKNEVKIKKERKNIPLN"
     atgagtacaa aatttgctaa atacaaagaa gttatttata aagttagtaa aattggtgat        60
     aatacagtaa gacttgttag tagtaatgag caagatatac aaaagggatt tgtaaagaaa       120
     gaatacccag ataactattt aaataaagaa aaattgccag acttatatat atgtgaagtt       180
     gacttttctt gtataaaaga gctgtatgaa atatcagata tagtcgtgta taaagaaaag       240
     gaatttgaat ctattactga aaccaaagat ttttttagaa ttggtactat aaatacagaa       300
     atagctaaag aattaaattt tgaaagaact gataaatatt attatgaaaa atgggtaccg       360
     aaaaatgaag taaagattaa gaaggaacga aaaaatatac ctttaaatta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page