(data stored in ACNUC10821 zone)

EMBL: AE017262.PE78

AE017262.PE78        Location/Qualifiers
FT   CDS_pept        81384..81638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0080"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02868"
FT                   /protein_id="AAT02868.1"
FT                   /translation="MTSEKTISRIDAKIDMALLPGWKNTRMYEAEIIIPKGQQINIGKV
FT                   APQAIESTGTILKGGVDQIVLPRNWSSDWIINIKSVPNK"
     gtgacttcag agaagacaat aagtcgaata gacgcaaaaa tagatatggc attattacct        60
     ggatggaaga atactcgcat gtacgaagca gaaataatta ttcctaaagg ccagcaaatt       120
     aatattggta aagtagcacc tcaagcaatt gagtcgacag gtacaatatt aaaaggcgga       180
     gtagaccaaa ttgttcttcc aagaaattgg tcttccgatt ggattattaa tattaagagt       240
     gttcctaata aatag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page