(data stored in ACNUC10821 zone)

EMBL: AE017262.PE79

AE017262.PE79        Location/Qualifiers
FT   CDS_pept        81770..82093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:19715005"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02869"
FT                   /protein_id="AAT02869.1"
FT                   /translation="MLNIKSGEQLSIGLPENVPRLLENNLITYFEKNQKINSAYLLQIV
FT                   RRQRDKSLLLVVDFNGGEGEFQRTVRELEMSITTEDIFEVISLDTDFSKEITEGKTPIY
FT                   NKQ"
     atgctgaata ttaaatcagg ggaacaactt tcaataggct tgccagaaaa cgttcctcga        60
     ttattagaaa ataatttaat tacatacttt gaaaaaaatc aaaaaattaa tagtgcttac       120
     ttattacaaa tagtgagaag acaacgagat aaaagcttat tattggttgt agatttcaac       180
     ggtggagaag gtgagtttca acgaacggta agggaattag aaatgagtat tactacggaa       240
     gatatatttg aagttatttc tttagatact gatttttcta aggaaataac agaagggaag       300
     acccccattt acaataaaca atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page