(data stored in ACNUC10821 zone)

EMBL: AE017262.PE81

AE017262.PE81        Location/Qualifiers
FT   CDS_pept        84049..84483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P40737"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02871"
FT                   /protein_id="AAT02871.1"
FT                   /translation="MKYSYLVSNKNNSFYPVSLEEIEEVEETLDLKIPKELKDFFLNVG
FT                   YGFIKGSKYNINRIMDPYSIRDFRLKQNDYEFFPDIEVYDELEEEIIFFEGSETALISI
FT                   KLTTEEKNKIYYDEFKIADSLEDFLAKISENDLYYMDLID"
     atgaagtata gttatctagt atcaaataaa aataatagct tttatccagt atcattagaa        60
     gagatagaag aagtggaaga gacattagat ttaaaaattc caaaagagct aaaagatttt       120
     ttcttaaatg ttgggtatgg ctttattaaa ggttctaaat acaatattaa tcgtatcatg       180
     gacccgtatt ctattagaga ttttcgatta aagcaaaatg attatgaatt ttttccagat       240
     attgaagttt atgatgaact tgaagaagag attatctttt ttgaaggtag cgaaacagcc       300
     ttaatttcaa ttaaattaac aacagaggaa aagaataaaa tctattatga tgaatttaaa       360
     attgccgatt ccctagaaga ttttcttgca aaaatatcag aaaatgattt gtattatatg       420
     gatttaattg attaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page