(data stored in ACNUC10821 zone)

EMBL: AE017262.PE82

AE017262.PE82        Location/Qualifiers
FT   CDS_pept        84907..85617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02872"
FT                   /protein_id="AAT02872.1"
FT                   /translation="MLAFAVGGSISEQSATGAAAIAAKKKLKDVMRNMDNLNVKGGGKA
FT                   GIIEETSKHFSPQKVTLENGEIAYKAKDGALVRSPEYLDKEGNIKWPEADGFVVDKAGK
FT                   PITVNADLKAGQIIDRYGNSFGKFTSPVEDGNILAYDTRGLPYPESAKTYHQYEVVTDI
FT                   NIENVVKAFDNLPSKEKAKFIDDMAYYDFSIKSMATPQIGEIAKVFGAGGGTQIQLATV
FT                   VDWYERLNLLKEIK"
     gtgctcgctt ttgcggtagg aggcagtatc tcggaacaaa gtgctaccgg agccgccgcg        60
     atagccgcga agaaaaagct gaaagatgtt atgcgaaaca tggataattt gaatgtgaag       120
     ggcggcggga aagctggtat aattgaggaa actagtaagc atttctcacc ccaaaaagta       180
     accttagaaa atggagaaat tgcttataaa gcaaaagacg gtgcattagt ccgttcacca       240
     gaatacttag ataaagaagg caatatcaag tggccagaag cggatggatt tgtggtagat       300
     aaggctggaa aacctattac ggtaaatgct gatttgaaag caggtcagat tattgatcga       360
     tatggaaact catttggtaa atttactagc cctgtagaag atgggaacat tttagcttat       420
     gatacaagag gattacctta tcctgaaagt gctaaaacgt atcatcagta tgaagtagtg       480
     accgatatta atatagagaa tgttgtgaag gcgtttgata atttaccctc taaggaaaaa       540
     gcgaaattta tagacgatat ggcttattat gactttagca ttaaaagcat ggcaacgcca       600
     caaataggcg aaatagcaaa agtttttggg gctggaggag gtacacaaat ccagctagcg       660
     acagttgttg attggtatga aagattaaat cttttaaagg agataaaata a                711
//

If you have problems or comments...

PBIL Back to PBIL home page