(data stored in ACNUC10821 zone)

EMBL: AE017262.PE84

AE017262.PE84        Location/Qualifiers
FT   CDS_pept        86108..86401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02874"
FT                   /protein_id="AAT02874.1"
FT                   /translation="MTVTSNINSELADGFQGYTDVRKITVNSTVDVGVSGSLTAVLGQV
FT                   GSSFGLPGAIGGLGVGLVLDTILSLNGTKDTWKNSINEKMQDLEDWFRVEAK"
     atgacagtta catctaatat aaatagtgaa ttagcagatg gttttcaagg atatacagat        60
     gtaaggaaga ttacagtgaa ttcaacagtt gatgtgggtg tttcaggaag tttaacagca       120
     gtacttggac aagtaggtag ttcttttggg cttccaggtg caataggtgg actaggagtt       180
     ggactagtgt tggatacgat tctgagctta aacggtacaa aagatacttg gaaaaatagt       240
     attaacgaaa aaatgcaaga tttggaagat tggtttaggg tggaagcgaa atag             294
//

If you have problems or comments...

PBIL Back to PBIL home page