(data stored in ACNUC10821 zone)

EMBL: AE017262.PE86

AE017262.PE86        Location/Qualifiers
FT   CDS_pept        87500..87682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0088"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02876"
FT                   /protein_id="AAT02876.1"
FT                   /translation="MLHTRVVGDLEKRLPVTLEKMVEYVESNRKEIITPIFIVLNYVEN
FT                   VPYVDVCVGIDPYDE"
     atgttgcata ctagagttgt tggtgatttg gagaagcggc tgccggttac tcttgagaaa        60
     atggtagaat atgtggaaag taataggaaa gaaattatta cgcctatttt catagtattg       120
     aattatgtgg aaaatgtgcc ttatgtggat gtgtgtgttg gaattgatcc ttatgatgag       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page