(data stored in ACNUC10821 zone)

EMBL: AE017262.PE88

AE017262.PE88        Location/Qualifiers
FT   CDS_pept        88367..88651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0090"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02878"
FT                   /protein_id="AAT02878.1"
FT                   /translation="MKIDLEQIYTLDFTMGLRFHPLIIRKNLPLLYVAFIFLIWIQGVV
FT                   MAGLPGDFDTTELDVLLATIPALPLLILYPKKMAMKFQNVQYLLYVCFN"
     atgaaaatag atttagaaca aatatacaca ttagatttca caatgggctt aagatttcat        60
     ccactaatta tcagaaaaaa tttaccgctt ctttatgtag cgtttatttt tctgatttgg       120
     atacaaggag tcgttatggc tggattgcct ggagattttg acacaacgga attagatgtt       180
     ttattagcaa caattccagc cctgccttta cttatattat atcctaaaaa aatggcaatg       240
     aaattccaaa atgttcaata tttattgtat gtatgtttca attga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page