(data stored in ACNUC10821 zone)

EMBL: AE017262.PE93

AE017262.PE93        Location/Qualifiers
FT   CDS_pept        91939..92895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0095"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02883"
FT                   /protein_id="AAT02883.1"
FT                   /translation="MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELIKNVTEV
FT                   DAIICPLSSPISAKVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATA
FT                   ELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVA
FT                   KRAAAFGMKIIYSGHHPKEAAKEWNAEFVSQEELLKRSDVVTIHAAYSPSLKYLLNETT
FT                   LKTMKSSAFLINAARGPVVEEAALIKALETGVIAGAALDVFEFEPKIGEDLAKLDNVVL
FT                   TPHIGNATVETRTAMGKIAIANVEAVLAGKAPLHSVY"
     atgacagcga gcgtatttgt ggcaggaaaa ttactaccag aaacgatgga agctcttagc        60
     aaatgggacg ttaaagcttt ttcaggtgag gaaaatatta cagaagcaga gttaataaaa       120
     aatgtaacgg aagtggatgc gattatttgc ccgctttctt ccccaatttc ggcaaaggta       180
     ttggaatcgg caaaaaatct taaaatcgtg gcgaatattg gtgccggttt tgacaatatc       240
     gatgtaaaaa aagcgcaaga attgggcatt gcagtgacca atacgccaga tgtgtcaacg       300
     gaagcaacgg cggaactaac gcttggattg attttggacg tagcacggag aatttcagaa       360
     ggcgaccgat tatgccgcga aacccccgag caattcaaag gctgggcacc aacgttcttt       420
     ttaggtactg aattaagtgg caaaacgctc ggaattattg gattaggaag aatcggacaa       480
     gctgttgcaa aacgtgcggc tgcttttgga atgaaaatta tttattctgg gcaccatccg       540
     aaagaagcag cgaaagagtg gaatgcagag tttgtgagtc aggaagaatt attgaagcgc       600
     agcgatgttg taacaatcca tgcggcatac agtcccagct tgaagtatct gttgaacgaa       660
     acaacactga aaacgatgaa atcaagtgcc tttttgatca atgctgctcg cggtcctgtt       720
     gtagaggaag ctgcactgat taaggcatta gaaacaggcg ttatcgccgg cgctgcgctg       780
     gatgtgtttg agttcgagcc taagattggc gaggatttgg ctaaactgga taatgtcgta       840
     ttaacacccc atatcggaaa cgcaactgtg gaaacacgca cagcaatggg caaaatagcc       900
     attgcaaatg ttgaagctgt cttagcagga aaagcaccac tacattctgt ttattaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page