(data stored in ACNUC10821 zone)

EMBL: AE017262.PE95

AE017262.PE95        Location/Qualifiers
FT   CDS_pept        94741..95118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0097"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02885"
FT                   /protein_id="AAT02885.1"
FT                   /translation="MGRIKVTINAEYIDNKLTAFGKSIEFKNKIVELKENDNCLFVRLL
FT                   VVPGQELNENTLSNVYAINKLGEIQWQIKNVAPKGNNVYICAPLVGMDIEENDLFVTDF
FT                   MGRRFEVNQENGELNQVRIVK"
     atggggcgga ttaaagtgac aattaacgca gaatacattg ataataaatt aactgctttt        60
     ggaaaaagca ttgaatttaa gaataaaatt gtagaattaa aagagaatga taactgttta       120
     tttgtgagat tattggttgt tcctggtcaa gaattaaatg aaaacacttt aagtaatgta       180
     tatgcaatta ataaattggg tgaaattcaa tggcaaataa aaaatgttgc gccaaaagga       240
     aataatgttt atatatgcgc accattggta ggtatggata tcgaagagaa cgatttattt       300
     gtaacagatt tcatggggcg gaggtttgaa gttaatcaag aaaatggtga actcaaccaa       360
     gtgagaatag tgaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page