(data stored in ACNUC10821 zone)

EMBL: AE017262.PE96

AE017262.PE96        Location/Qualifiers
FT   CDS_pept        95591..95935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0098"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02886"
FT                   /protein_id="AAT02886.1"
FT                   /translation="MTKITHMNNKLIFENQEYTFEYPIQTLREDKNHVYVLLDIPANQE
FT                   YTFDDFHNIYAFSYTGERKWQIGERPVGDNDVYTLINVKEGILYATDFSGRKYKVCEKN
FT                   GIPEKMEIVK"
     atgacgaaga taactcatat gaataataaa ttaatttttg aaaaccaaga atacacattt        60
     gagtatccaa tacaaacttt gagagaagat aaaaatcatg tatatgtttt attagatata       120
     ccagccaacc aagaatatac gtttgatgat tttcataata tttatgcttt ttcttatacg       180
     ggtgaacgga aatggcaaat aggagagaga cccgttggag ataatgatgt ttatactttg       240
     attaatgtaa aagaaggaat actttacgct acagatttta gcggaagaaa atataaagtt       300
     tgtgaaaaaa atggaattcc tgaaaaaatg gaaattgtaa aataa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page