(data stored in ACNUC10821 zone)

EMBL: AE017262.PE97

AE017262.PE97        Location/Qualifiers
FT   CDS_pept        96061..96402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02887"
FT                   /protein_id="AAT02887.1"
FT                   /translation="MKKLQWLTNRLFATSILLITTLFIIPPTFAIADGSKVSFYEYIYG
FT                   APFRWLTVISTTDKKGAFTEMFFSGNEGITIQWPNLMINFLLIFLAITIIFSLAKKLYD
FT                   KKNVKKDNP"
     atgaaaaaac tacaatggct aactaaccga ttatttgcaa cctctatcct cctaatcacc        60
     acgttattta tcataccccc aacatttgcg atagctgatg gaagtaaagt gagtttttat       120
     gaatacatat atggagcacc ttttagatgg ctaactgtaa ttagtacgac agataagaaa       180
     ggtgcattta cggagatgtt tttctcggga aacgagggta taactatcca atggcccaat       240
     ctaatgataa actttctctt aattttcctt gcaataacta ttatcttttc cctagcaaaa       300
     aagctttacg ataaaaagaa cgtcaaaaaa gacaacccat aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page