(data stored in ACNUC10821 zone)

EMBL: AE017262.PE98

AE017262.PE98        Location/Qualifiers
FT   CDS_pept        complement(96469..96837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0100"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02888"
FT                   /protein_id="AAT02888.1"
FT                   /translation="MAFSIGEFSELVGIPSSTLRFYEKEGLITPDRDKNNLRIYSEEDA
FT                   NWLKFLLHLKGAGLSVEELKQYTIWRAAGDSTISERLNMLKKKKVILEQEIEDLQKNLD
FT                   TVVRKIGIYEEKVKTRRV"
     atggcttttt ctatcggtga attttccgaa ctagtaggca ttcccagtag cacccttaga        60
     ttctacgaaa aagaaggctt aataacccct gaccgcgaca agaataattt gcgcatatac       120
     agcgaagaag acgccaattg gctaaaattt ttactgcact taaaaggcgc cgggttatcg       180
     gtagaagaat taaagcagta cacaatttgg cgcgcagcag gagacagcac tatttccgaa       240
     cgattaaata tgttaaaaaa gaaaaaggtt attttggagc aagagattga agacttgcag       300
     aagaatttgg atacagtggt taggaagatt gggatttatg aagagaaggt taagactaga       360
     cgagtttag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page