(data stored in ACNUC10821 zone)

EMBL: AE017262.PE99

AE017262.PE99        Location/Qualifiers
FT   CDS_pept        complement(96893..97876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0101"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02889"
FT                   /protein_id="AAT02889.1"
FT                   /translation="MKKRQLGNTGLVTSELGFGCMGLNYHRGPAKDRKEMIEVVRTAMD
FT                   AGITMFDTAEVYGPYTNEELVGEALVGKRNHVQIATKGGFKINGLNNEVDSRPESIKAA
FT                   VEGSLKRLKTDYIDLYYIHRIDPSIPIEEVAGTIQNLKQEGKILHWGLSEASAKTIRRA
FT                   HKVEPLAAVENEYSIWWREAEKEIFPVLEELGIGLVAYSPLGRGYLTGKLDINASFNEN
FT                   DNRGGLPRFQKEAMEANQVLLDFMKEIADEQNVTTAQLAIAWILDQKPWIVPIPGTTKQ
FT                   SRIKENIASTDIRFDDGARQKIADALSQIEIVGDRYSAAENKRIGK"
     atgaaaaaga gacaattagg aaacactggt ttagtaactt cagagcttgg attcggctgt        60
     atgggactca attatcaccg gggacctgcg aaagatagaa aagaaatgat tgaagtcgta       120
     cgcactgcaa tggatgcagg gattacgatg ttcgatactg ctgaagtgta cggaccttat       180
     actaatgaag aacttgtcgg agaagcttta gttggcaaaa gaaaccatgt tcaaattgca       240
     acaaaaggtg gttttaaaat taatggttta aataacgaag tcgatagccg tccagaaagc       300
     atcaaggccg cggttgaagg ctctctcaaa cggctaaaaa cggattacat tgatttatat       360
     tacattcata gaattgaccc ctctatccca attgaagagg ttgccggaac cattcagaat       420
     ttaaaacaag aaggaaaaat tctacactgg ggactttccg aagccagcgc aaagacaata       480
     cgccgtgctc ataaagtaga gccactagct gctgttgaaa atgagtattc catctggtgg       540
     cgagaagctg aaaaagaaat atttccggtt ttagaagaac ttggcatcgg gcttgtcgca       600
     tacagcccac taggtcgcgg ttatttaact ggcaaattgg atataaatgc tagcttcaat       660
     gaaaacgaca accgcggtgg cttaccaaga ttccaaaaag aagccatgga agccaaccaa       720
     gtactactcg attttatgaa agaaatagcc gacgagcaaa atgtcacaac ggcacaactc       780
     gccatcgctt ggatacttga ccaaaaacct tggatcgtgc caattcccgg aacaacaaaa       840
     caaagcagaa ttaaagaaaa tatcgcctcc acggacattc gttttgatga cggagcacga       900
     caaaaaatag ctgatgcttt atcgcagatt gaaattgttg gtgatagata ctcagcagct       960
     gaaaataaac gcatcggaaa gtag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page