(data stored in ACNUC10821 zone)

EMBL: AE017262.PHRB

AE017262.PHRB        Location/Qualifiers
FT   CDS_pept        635685..637088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="LMOf2365_0617"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="identified by similarity to SP:P25078; match to
FT                   protein family HMM PF00875; match to protein family HMM
FT                   PF03441"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03399"
FT                   /protein_id="AAT03399.1"
FT                   /translation="MTSVMWFRRDLRVNDNKALYHACKENDLLLLFQVNPAQFITGSPS
FT                   HQAFFASVAHFKQEIDKTAHLQIMFGEPIECFQQLKDSLPSWDKVYFNRDETGYGAKRD
FT                   EAAQAFFDEQKIEVQAFHDSYLHSAEEVKKSPTEYYKIFTPYYKKWREEIKETPFKVTL
FT                   KHENIRKESLFLKYEEQFAEMTSDLPILDIGERAANTRLANFIKHDVADYDKARDFPEL
FT                   DKTSHLSRYLRTGEISIRTIWQSLQETEATEGRATFEKELCWRDFYNMIYVSFPNQKNE
FT                   PIQENYRFIEWENNREYFKAWQEGKTGFPLVDAAMRQLKETGWMHNRLRMITASFLTKD
FT                   LLIDWRFGEKYFQQMLIDYDPASNIGGWQWAASTGTDAVPYFRIFNPTTQSQKFDSTGK
FT                   FIRKYVKELANLPDKYIHQPEKMSETEQKEHGLLLGKDYPFPIVDHKERRKLAIARYEF
FT                   SKEHSRGNI"
     atgacttcgg taatgtggtt tcggagagat cttcgagtaa acgataataa agctctctat        60
     catgcttgta aagagaacga tttgcttttg ttatttcaag taaatccagc acagttcatc       120
     acaggaagtc ctagccacca agcttttttt gcaagtgtgg ctcattttaa gcaagaaatc       180
     gataaaactg cgcatttaca aatcatgttt ggtgaaccga tagaatgctt ccaacaactt       240
     aaagattcgc taccaagctg ggataaagtt tatttcaacc gtgatgaaac aggatacgga       300
     gcaaagcggg atgaggcggc gcaagcgttc tttgacgaac aaaaaatcga ggttcaagcc       360
     ttccacgata gttatcttca ttcagcggaa gaagtaaaga aatctccaac agaatactat       420
     aaaattttta ccccttatta taaaaaatgg cgcgaagaaa taaaagaaac gccgttcaaa       480
     gtgactttaa agcatgagaa tatccggaaa gaaagcttgt ttctgaaata tgaagaacaa       540
     tttgcggaaa tgactagcga tttaccgata ttagatattg gtgaacgagc agcgaacacg       600
     agacttgcga attttattaa acacgatgtt gctgactatg acaaagcgag agatttcccg       660
     gaactggata aaacaagcca tttatcacgt tatttacgga cgggggaaat ctcgattcgg       720
     acgatttggc agtcacttca agaaacagaa gcaacagaag gacgagctac atttgaaaaa       780
     gaactttgtt ggcgcgactt ttataatatg atttacgttt cttttcctaa ccaaaaaaac       840
     gagccgatcc aagaaaatta tcgttttatt gaatgggaaa ataaccgtga atatttcaaa       900
     gcgtggcaag aagggaagac tggtttcccg ctcgttgatg cggcgatgcg ccagttgaaa       960
     gaaactggtt ggatgcataa tcgactaaga atgattacgg cgtccttttt aacaaaagat      1020
     ttgctgattg attggcgttt tggcgaaaag tattttcaac aaatgctgat tgattatgat      1080
     cctgcgagta atattggtgg ctggcaatgg gcggcttcga ctggaacgga tgcggtgcca      1140
     tactttagga ttttcaaccc aacgacacaa tcacaaaaat ttgattcgac tgggaaattt      1200
     attcgaaaat atgtaaaaga gttagcgaat ctacctgata aatatattca tcaaccagaa      1260
     aaaatgtcag aaactgagca gaaagagcat ggcttgctgt taggaaaaga ctatccattt      1320
     ccgatagttg accataaaga acgacggaaa ttagccattg cacgctacga gtttagcaaa      1380
     gagcattcta ggggaaatat atag                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page