(data stored in ACNUC10821 zone)

EMBL: AE017262.PLCA

AE017262.PLCA        Location/Qualifiers
FT   CDS_pept        complement(209983..210936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plcA"
FT                   /locus_tag="LMOf2365_0212"
FT                   /product="1-phosphatidylinositol phosphodiesterase"
FT                   /note="identified by similarity to GP:887021; similarity to
FT                   SP:P34024; match to protein family HMM PF00388"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02999"
FT                   /protein_id="AAT02999.1"
FT                   /translation="MYKNYLQRTLVLVLCFILCFFTFPLGGKAYSLNNWNKPIKNSVTT
FT                   KQWMSALPDTTSLAALSIPGTHDTMSYNGDMTWTLTKPLAQTQTMSLYQQLEAGIRYID
FT                   IRAKDNLKIYHGPIFLNASLSGVLETITQFLKKNPKETIIMRLKDEQNSNDSFDYRIQP
FT                   LINIYKDYFYTTPRTDTSNKIPTLKDVRGKILLLSENHTKKPLVINSHKFGMQFGASNQ
FT                   VIQDDYNGPSVKTKFKEIVQTAYQASKADNKLFLNHISATSLTFTPRQYAAALNNKVEQ
FT                   FVLNLTSEKVRGLGILIMDFPEKQTIKNIIKNNKFN"
     ttgtataaga attatttgca acgcacatta gttttagtac tctgttttat tttatgcttt        60
     tttactttcc cattaggtgg aaaagcatat tcgcttaata actggaataa gccaataaag       120
     aactctgtaa ctacaaagca atggatgtcc gctctacctg acacaacgag cctagcagca       180
     ctctctatac caggtacaca tgatacgatg agctataacg gagacatgac gtggacatta       240
     accaaaccac tggctcaaac acaaacgatg tcattgtacc aacaactaga agcaggaata       300
     cggtacatcg atattagagc aaaagacaat ctcaaaattt accatgggcc aattttttta       360
     aatgcatcac tttcaggcgt attagaaacg attactcaat ttttaaagaa aaatccaaaa       420
     gaaaccatta ttatgcgttt aaaagacgag caaaacagca acgatagttt tgattatcgg       480
     atccaaccac taatcaacat ttacaaagat tatttttaca ctactcccag aactgacacg       540
     agcaataaaa tccctacatt aaaagatgtc cgcggaaaaa tattattact ttcagagaac       600
     cacacaaaaa agccattagt cattaattca cacaaattcg gcatgcagtt cggcgcatcc       660
     aaccaagtaa ttcaagatga ctacaatggt ccgagtgtga aaacaaaatt caaagagatt       720
     gtccagactg cttatcaagc ttctaaagcg gacaacaaac tgtttcttaa ccatattagt       780
     gccacttcat taacattcac acctcgtcag tatgctgcag cattaaacaa caaagtagag       840
     cagttcgtac tcaacttaac atcggaaaaa gttcgaggat taggcattct aatcatggac       900
     ttccccgaaa aacaaactat caaaaacatc ataaaaaaca ataaattcaa ctaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page